KEGG   Musca domestica (house fly): 101890504Help
Entry
101890504         CDS       T03448                                 

Gene name
SOD
Definition
(RefSeq) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mde  Musca domestica (house fly)
Pathway
mde04146  Peroxisome
mde04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101890504 (SOD)
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101890504 (SOD)
Enzymes [BR:mde01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101890504 (SOD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 101890504
NCBI-ProteinID: NP_001295981
UniProt: Q6SCL6
LinkDB All DBs
AA seq 153 aa AA seqDB search
MPAKAVCVINGDAKGTVFFEQTDESSPVVVTGEVTGLSKGLHGFHVHEFGDNTNGCTSAG
PHFNPKGKEHGAPSDENRHVGDLGNIEASGDGPTKVNITDSQISLFGANSILGRTVVVHA
DPDDLGKGGHELSKSTGNAGARIGCGVIGIAKI
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctaaagctgtctgtgttattaacggtgatgccaaaggcactgttttctttgaa
caaaccgacgaatcttctcctgttgttgtaactggtgaggttactggtttgtccaagggc
ttacatggcttccacgtccatgaattcggtgacaacaccaacggatgtacatcagctgga
ccccatttcaatccaaaaggcaaagaacatggtgcaccctccgatgagaaccgtcacgtt
ggcgatttgggtaatattgaagccagtggagatggcccaacaaaggtcaacatcactgat
tctcaaattagtctgttcggcgccaatagcattttgggacgtacagtcgtcgtacatgcc
gatcccgatgatttgggcaagggtggccatgaattgagcaagtcaactggaaacgctggt
gctcgcattggttgcggtgtaattggaattgctaaaatttaa

DBGET integrated database retrieval system