KEGG   Musca domestica (house fly): 101891328Help
Entry
101891328         CDS       T03448                                 

Definition
(RefSeq) ALK tyrosine kinase receptor
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
mde  Musca domestica (house fly)
Brite
KEGG Orthology (KO) [BR:mde00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mde01001]
    101891328
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mde04090]
    101891328
Enzymes [BR:mde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101891328
Protein kinases [BR:mde01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   101891328
Cytokine receptors [BR:mde04050]
 Receptor tyrosine kinase
  RTK class X (LTK receptor family)
   101891328
CD molecules [BR:mde04090]
 Proteins
  101891328
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr MAM Pkinase Gly_rich Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 101891328
NCBI-ProteinID: XP_005176990
UniProt: A0A1I8N408
LinkDB All DBs
Position
Unknown
AA seq 1781 aa AA seqDB search
MPRSLPHSTAAMVRQQFGVATLCFVTLTLSSVPVREIEAQRPLSNHTTYNTIPTGQHNYK
LRNGRTHDFIIPPTTVASIPRGILGGGVPIYEDLEGTLVPPLGGRRDNRRRLSYQALANM
HRGSSSGRGMESLRKELMKPSVGGPGGGISGNSPGYPSYAATSSIGKIDGLGRVGPAQRY
GDNLHQAGVLFSTSMPPQAFYVPDSMDGKFTRFSTKVNSINEIRRMNKNQADQPMRGIDD
DIIMEEHPDPLQAIKEQLMNSQPQPMIHPASSQNFDIEDLLGVRCTFETPCAWKWTDNLP
DGFHIMSGTEVSKKNMTGLYPGPLADNSDDANGHFLYARLAPTTLQINLTSPQFSSTMEK
CVLELYMHQSGMSHGLSRVVVMPLHSQENSWVPAEIVGDNYRTWDKKSFRLGRISRDFRL
VFEIVPKLLEGQKAHVAIDNLRMVNCFPEGTKSEKCSTSQVKCMNNKVSVCIPLPRICDI
TRDCDNAEDELLNCEKIPFGARCDFENDWCGWRDSGRTILSWSRHTGSSPTLDTGPEGDH
TYHHLTNGSGGYYMLVNMNQHSNNSEKYQQIGFASNAIMISRTFNPPPSVHGDPHSPYRN
SCVVRFYIHQFGKNPGSINLSVVEMKEKENITTTLWWSTKNQGEDWMRAEYILPNITSRY
YLQFEARMGMRIYSDVAVDDFSLSPECFGINIPPEHLNGYNYWNVRHTKSPTHKDFENHN
YLELGTCDNRGMHGPTQSQCESFYTSHNRTNVLEEVKVTDEIPYKGMQKWRVPHEGFYTF
IVKGASGGLGSTGVGSSRGAVAVAVLELHKNEELYLLVGQQGENACSKSMGAKEDNCNFS
SSAIVNGNNGAGGGGGGSYVFLLNSARNEAVPLVVAGGGGGLGVGRYLDEAFQHGQKENS
GRRGLTGQIHGEQLSKEGSAGPGGGWRANADQALDARYGAALLLGGRGGFSCYVDMETNG
SVTKRYGQGGFGGGGGGCDTGGGGGGFAGGDVYLNESNGEGGSSYISASRTLKELSSIYE
GANFGAGSIIIIPAIEGCGCDYRCLALDEYRSSVKCICPEGWRIRKDNTSACDMPATDTI
PLKYLISFFTVLMLLLIASLAALVVMLYNRYQRKKLAKERHKMLREQDMQLTRLRHNIDE
NNLNNFNPNYGCDDLINGQINVNSLPQVARESLRLVKALGQGAFGEVYQGLYRHRDGDAV
EMPVAVKTLPEMSTRQAEEDFLMEAAIMAKFNHPNMVHLIGVCFDRHPRFIVLELLAGGD
LKNFLREGRHKPERPSPLTMKDLVFCALDVAKGCRYMESQRFIHRDIAARNCLLSSKGPG
RVVKIADFGMARDIYRSDYYRKGGKAMLPIKWMPPEAFLDGIFTSKTDVWSFGVLLWEVF
SLGLMPYTGLPNPEVMQLVTNGGRLGTPPGCPPVIYKIMADCWNPTPEDRPTFSSLLERL
KAVTEDPTVMNAPLPHILRPPSNERDQTIIRPQGVDDVCLQVPTTSDYLIPLPGITHLHQ
QQQQLQQATQQQQHDIIDPSCPMAISTGTNICTPPGVSSPSAPQHTQLLKEDEHTNATNE
GCWETSFILPNSKSDQPLLNNNNSSGSQKSINTASIGAQGPGNTSGYSSSSQRSPVSNGL
RTIQSSSATPAHEDEETKLISSDTPQPTPTTIQPPLSFSSQLDGITLDPAALTKSLNTNV
TVPNAAAVAAAAQAATTNTNLNNKHSSYANIQMMSSSVNNLKGNCSDTPSEKLNGSLLHN
GSNGLTKMNGNLATNGNTNAPPFTIQGYAERYKDKHSEISC
NT seq 5346 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgctcattaccccattcaacggcggccatggtgcgccaacaattcggcgttgcc
acattgtgttttgtaacgctcaccctgagttctgtcccggtgcgggaaatcgaagcccaa
cggccattgtcgaatcacacaacctataatacgataccgacgggacaacataattataag
ctgcgcaatggacgaacccatgattttattataccacccaccacggtggcctctataccc
cgaggcatcctgggtggcggagtaccaatctatgaagacttggaaggcacgttagtacca
cctctgggaggtcgacgtgataatcgccgtcgcctcagctatcaggcattggctaatatg
catcgtggtagcagcagtggtcgtggcatggaatctctgcgcaaagaactaatgaagcca
tcggtgggaggtcctggaggtggcattagtggcaacagtcccggttatccctcgtatgcg
gcgacctcatccattggcaaaattgatggtttgggtcgggttggaccggcccaacgttat
ggtgataatttacatcaggccggagttttgttctccaccagtatgccgccacaggctttt
tatgttcccgactcaatggatggcaagtttacacgtttttcgaccaaagtaaattccatc
aatgaaatccgtcgaatgaataaaaatcaagctgatcaacccatgcgcggcattgatgat
gacattatcatggaagaacatccggatcctctgcaggcaattaaagagcaattgatgaat
tcccagccgcaaccgatgatccatcctgcctcgtcgcaaaatttcgacatcgaagaccta
ctcggcgtgcgatgtacatttgaaacaccctgtgcttggaaatggaccgacaatttacca
gacggttttcacattatgagcggtactgaggtgtcaaagaaaaacatgactggcctctac
cccggccctctggccgataactccgatgatgccaatggtcatttcctctatgctcgactg
gctccaactacgttacaaatcaatttgacttcgccacaatttagttcgacaatggaaaaa
tgtgtactcgagctatatatgcatcaaagtggcatgagtcatggtctatcgagggtcgtg
gtaatgcctcttcattcacaggagaattcatgggttccggcagaaattgtgggagataat
tatcgtacatgggataagaaatcgtttcgtttgggacgcatttcaagagattttcgtttg
gtttttgaaattgtaccaaaactgctggagggacagaaagctcatgtggccatagataat
ttgcgtatggtgaattgtttccccgagggtacgaaatcggaaaagtgcagtacgtctcag
gtgaagtgtatgaataataaggtatcggtgtgtatacctttgccaagaatttgtgacatt
acgcgagattgtgacaatgccgaggatgagctgctcaattgtgaaaaaattccctttggt
gcccgttgtgatttcgaaaatgattggtgtggttggcgagactcgggtcgcaccattctc
tcgtggtccagacacacaggctcctcacccaccctggacaccgggccagagggtgatcac
acctatcatcatcttaccaatggcagtggtggctattacatgttggtcaacatgaatcag
cacagcaacaacagcgaaaaatatcaacaaatcggctttgccagcaatgccatcatgatc
agtcgcaccttcaatccaccaccctccgtgcatggtgatccccattcaccctatcgcaat
agttgtgtggtgagattctatattcaccaatttggcaagaatcccggcagcattaatctc
tcggtggtggaaatgaaagagaaggagaacataaccactacactgtggtggagtacaaaa
aatcagggagaggattggatgagagcggaatacattttgccaaatatcacatcgagatat
tatctacagtttgaggctcgcatgggcatgagaatttattcagatgtggcagtcgatgat
ttttctttgtccccggaatgttttggcatcaatataccacctgaacatctgaacgggtat
aattactggaatgtgcggcacacgaaaagtccgacgcataaagatttcgaaaatcataat
tatctggagcttgggacatgcgataatcggggaatgcatgggcccacgcagtcgcaatgt
gagagcttttataccagtcacaatagaactaatgttctggaggaagtaaaggtcaccgac
gagataccctacaagggtatgcagaaatggagggtaccgcatgaaggattctatacattt
attgtcaagggagccagtggtggtttgggctcaaccggtgtcggctcctcgagaggtgct
gtggcagtggccgtcttggagttgcataaaaatgaggagctctatttgctggtgggccag
cagggtgaaaatgcctgctccaaatccatgggagccaaggaagataattgcaatttcagt
tcctcggccattgtgaacggcaacaatggtgccggaggtgggggtggtggatcctatgta
tttttgctgaactctgcccgcaatgaggctgtgcctttggtggtggctggcggtggagga
ggcttgggagtgggccgttatttggatgaagcctttcagcatggccaaaaagagaactct
ggaagacgcggcttgaccgggcaaatccatggtgaacaattatcgaaagaaggaagtgct
ggacctggtggcggctggagagccaatgccgatcaggccctggatgccagatatggtgcc
gccctgttgttgggtggacgtggtggtttctcttgctatgtagacatggaaacaaacggc
tcggtaaccaaacgttatggccagggtggctttggaggaggcggcggtggctgtgatacc
ggaggtggtggtggaggttttgccggtggtgatgtctatctcaacgaatcgaatggtgag
ggaggctcttcgtatattagtgcctccaggaccctcaaggagcttagttcgatctatgag
ggtgccaatttcggggctggttcgattatcatcatacccgccattgagggttgtggttgt
gattatcgttgcctggctttggatgaatatcgctcgtcggtgaaatgtatctgccccgag
ggttggagaatacgcaaagacaatacttcagcatgtgatatgcctgcaaccgataccatc
cccttgaaatatttgatatccttctttacggttttgatgctgctgctaattgcatccctg
gcagctttggttgtaatgctgtacaatcgctatcaacgcaaaaaactggccaaggaacgc
cacaaaatgctacgggaacaggacatgcaattgacccgcctgcgccacaacatcgatgag
aacaatctcaacaacttcaatcccaactatggatgcgatgatctcatcaatggccaaata
aatgtgaatagtctacctcaggtggcccgtgaaagcttgagattggtcaaggccctgggc
cagggagcatttggtgaggtctatcaaggcctgtatcgtcatcgtgacggcgatgccgtg
gaaatgccggtggccgtcaagaccctacccgaaatgtccacacgccaggcggaggaggac
ttcctaatggaggctgccataatggcgaaattcaatcatcccaacatggtccatctgata
ggtgtttgctttgatcgccatccacgtttcattgttttggagctgctggctggtggagat
ttgaaaaactttttacgcgagggacgccacaaaccggaaagaccctcacctctcaccatg
aaagatttggtattttgtgccctggatgtggccaagggttgccgctatatggagagtcaa
cgtttcatacatcgcgatatagcggcccgcaattgtttgctgagcagtaagggtcctggt
cgtgtggtgaaaattgccgatttcggtatggccagagatatttatcgcagtgattattat
cgcaagggtggcaaggctatgctacccatcaaatggatgccacccgaggcatttttggat
ggtatttttacgtccaaaacagatgtttggtcgtttggagttttattgtgggaggtcttt
agcttgggcctaatgccctataccggcctcccaaatcctgaggtaatgcaattggttacc
aacggtggccgtttgggcacaccacccggttgtccaccggtcatctataaaatcatggcc
gattgctggaatcccacaccagaagatcgtccaacattttctagtctcctggagcgcctc
aaggccgtaacagaggatcccactgttatgaacgctccattgccccacattttacgcccg
ccctctaatgaacgcgatcaaaccattatacggccgcagggtgtcgatgacgtttgcctg
caggtaccaaccacatccgattacttgatacccctgccgggtatcacacatctacatcaa
cagcaacaacagttgcaacaagccactcagcaacaacaacacgacataatcgatcctagc
tgtcccatggctatatcgactggaaccaatatctgtacaccgcccggcgtgtcatcaccc
tcggcaccacagcacacgcagctgctgaaagaggacgagcacaccaatgccaccaacgag
ggatgctgggagacatcattcattttacccaactcgaaaagtgatcagccactgctcaac
aacaacaattcgagtggatcgcagaagagcatcaacaccgcttccattggggcccaaggc
ccgggcaatacgagcggttacagcagcagtagtcagcgatcgcccgtctcgaatggccta
aggacaatacaatcttcttcagcaacgccggcccacgaggatgaggagacgaaactcatc
agctcagatacgccacagccaacaccaaccacaatacaaccgccattgtcattttcatca
cagctggatggtataactctagatccggccgctttaacaaagagtctgaacacaaacgta
acagttccaaatgccgcggcagtagcagcagcagcgcaagcagcaacaacaaatactaat
ctaaataacaaacactcgtcgtatgccaacatccaaatgatgtcctcatccgtgaacaat
ctgaagggtaattgcagcgatactccctccgagaagctaaatggaagcctgctgcacaac
ggcagcaatggcctcacgaaaatgaatggcaatttggccacaaatggtaacacaaatgcc
ccaccctttaccatacagggttatgcggaacgttataaggacaaacattcagagatcagc
tgttaa

DBGET integrated database retrieval system