KEGG   Musca domestica (house fly): 101891392Help
Entry
101891392         CDS       T03448                                 

Definition
(RefSeq) ATP-dependent 6-phosphofructokinase isoform X1
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mde  Musca domestica (house fly)
Pathway
mde00010  Glycolysis / Gluconeogenesis
mde00030  Pentose phosphate pathway
mde00051  Fructose and mannose metabolism
mde00052  Galactose metabolism
mde01100  Metabolic pathways
mde01200  Carbon metabolism
mde01230  Biosynthesis of amino acids
mde03018  RNA degradation
Module
mde_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101891392
   00030 Pentose phosphate pathway
    101891392
   00051 Fructose and mannose metabolism
    101891392
   00052 Galactose metabolism
    101891392
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101891392
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mde01009]
    101891392
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mde03019]
    101891392
Enzymes [BR:mde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101891392
Protein phosphatases and associated proteins [BR:mde01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101891392
Messenger RNA biogenesis [BR:mde03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101891392
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 101891392
NCBI-ProteinID: XP_005179004
UniProt: A0A1I8MFB9
LinkDB All DBs
Position
Unknown
AA seq 785 aa AA seqDB search
MATTTTVKQRFIERGSHKGKGLAVFTSGGDSQGMNAAVRACVRMAIYLGCKAYFIREGYQ
GMVDGGDNIVEANWASVSSIIHRGGTVIGSARCMDFKQRAGRLKAANNLIQRGISNLVVI
GGDGSLTGANLFRQEWSSLLDELLKNGQITEEQKTKYAVLHIVGMVGSIDNDFCGTDMTI
GTDSALHRIIEAIDAIVSTAYSHQRTFIMEVMGRHCGYLALVAGLSCEADFIFIPEAPPS
TDWPEKLCHKLNQERNAGQRLNIIIVAEGAIDRDGKPISAEDIKKVVVDKLQQDTRITVL
GHVQRGGNPSAFDRVLGCRMGAEATLALMEATSESVPVVVSLDGNQAVRVPLMECVERTQ
AVAKAMADKNWELAVKLRGRSFERNLETYKMLTRLKPPKREGQVSGYRLAVMHIGAPACG
MNAAVRSFVRNCIYRGDTVFGIHDGIEGLIAGNIKEMGWSDVTGWVGQGGAFLGTKRTLP
ECKFNEIAARLKEFKIQGLLIIGGFEAYHACGQIADQRANFPEFCIPMAVIPSTISNNVP
GTEFSLGCDTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGADAAY
IFEEKFSIKDLQQDVYHMASKMAEGVQRGLILRNEKASENYNTDFIYRLYSEEGKGLFSC
RMNILGHMQQGGSPTPFDRNMGTKMAAKCVDWFSEQFKNNKQADGTIKCTNKESAVLLGI
VRRQYRFTPLADLIAETNFEQRIPKTQWWLKLRPLLRILAKHDSAYEEEGLYITVEEECS
TDAVA
NT seq 2358 nt NT seq  +upstreamnt  +downstreamnt
atggctacgactacaacggttaaacaacgtttcatcgaacgtggctcccataagggtaaa
ggtctggctgtgttcaccagtggaggtgattcgcagggtatgaatgccgctgttcgtgcc
tgtgttcgcatggcgatttatttgggatgcaaggcctacttcattcgtgaaggctaccag
ggtatggtagatggtggcgataacattgtcgaagccaattgggcctctgtatcgtccatt
attcatcgtggtggcactgttattggttcggccagatgtatggactttaagcaacgtgca
ggccgcttgaaggctgccaataacctcattcaaagaggaatttccaatttggttgtcatt
ggtggtgatggttctttgactggtgctaatctcttccgtcaagaatggtcttccttgttg
gatgaacttttgaaaaatggacaaattactgaagagcaaaaaaccaaatatgctgttttg
catattgttggtatggttggctccatcgataatgatttctgtggtaccgacatgacaatt
ggtaccgattccgctttgcatcgtattatcgaggccattgatgccattgtcagcactgct
tactctcatcaacgtacattcattatggaagttatgggcagacactgcggttatttggct
cttgtagctggtttatcatgtgaagctgattttattttcattcctgaagctcctccatca
actgattggcctgaaaaactttgccataaattgaatcaggagcgtaatgctggtcaacgc
ttgaatattattattgtcgccgagggtgctattgatcgtgatggcaaacctatctctgcc
gaagatattaaaaaggttgttgtggacaagttgcaacaggatacccgtattaccgtattg
ggtcatgtccaacgtggtggtaatcccagtgctttcgatcgtgttttgggttgtcgtatg
ggtgccgaagccacattggctttaatggaagccacctcggaatcagtacctgttgtcgtc
tccttggatggtaatcaagctgtacgtgtgcccttgatggagtgtgtcgaacgcactcaa
gctgttgccaaggccatggctgacaagaactgggagttggctgtcaaactacgtggtcgt
tcgtttgagcgtaacttggaaacctacaagatgttgacccgcttgaagccaccaaagcgt
gagggacaagtgagtggttaccgtttggctgtcatgcacattggtgctccagcctgtggt
atgaatgctgccgttcgcagttttgtgcgtaattgcatttatcgtggtgataccgtcttc
ggtatccacgatggtattgaaggtttaattgctggcaatattaaagaaatgggctggtcc
gatgtcaccggctgggttggccaaggtggtgctttcttgggtactaaacgtaccttgccc
gaatgcaagttcaatgaaattgctgctcgcctcaaggagttcaagattcaaggtcttttg
attattggtggtttcgaagcttatcatgcttgtggacaaattgccgatcaacgtgcaaat
ttccctgaattctgtattccaatggccgttattccatcgaccatttccaacaatgtacct
ggcaccgaattctccttgggttgcgacaccggtctcaatgaaatcaccgaaatttgcgat
cgcattcgtcaatctgctcaaggtactaagcgtcgtgtgttcgtcattgaaaccatgggt
ggttattgtggttacttggccacattggctggtttggctggcggtgctgatgctgcctac
attttcgaggagaaattctcaattaaggatttgcaacaggatgtctaccacatggcctcg
aagatggctgaaggtgtacaacgtggtttaattctgcgcaatgaaaaggcttctgagaac
tataataccgatttcatttatcgtttgtattctgaggaaggcaaaggtttattctcctgt
cgtatgaatattttgggtcacatgcaacagggtggctctcccacaccttttgatcgtaac
atgggcaccaaaatggcagccaaatgtgttgattggttctctgaacaattcaagaataac
aagcaagctgatggcactattaaatgcaccaacaaagagtcggctgtgcttttgggcatt
gttagacgacaatacagatttactccattggctgatttaattgctgaaactaactttgaa
caacgtattcctaagacacaatggtggctgaaattgcgtccccttctcagaatattggct
aaacacgactctgcctacgaggaagaaggtttgtacattaccgtagaagaagaatgctct
accgatgccgtggcctaa

DBGET integrated database retrieval system