KEGG   Musca domestica (house fly): 101891696Help
Entry
101891696         CDS       T03448                                 

Definition
(RefSeq) pyrimidodiazepine synthase
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
mde  Musca domestica (house fly)
Pathway
mde00480  Glutathione metabolism
mde00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    101891696
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101891696
Enzymes [BR:mde01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     101891696
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 101891696
NCBI-ProteinID: XP_005179282
UniProt: A0A1I8N5F5
LinkDB All DBs
Position
Unknown
AA seq 255 aa AA seqDB search
MSGGKHLAKGSAKPEVPDDGKLCLFSMRFCPYAHRVHLVLDAKKIPYHSVFINLNEKPEW
LTEYSPLGKVPALQLPKEEGCPPLIESLVIAEYLDEKYPEPKLYPTDPLKKAQDKILIER
FNAVIGPMYKIFVNNEVSPGTITDVSNGLDIFEKELRSRGTEFFGGDKPGMLDYMIWPWC
ERSAMLKYLLSDKYEMDKERFEKLLKWRDLMEKDEAVKCFYLDGETHAKFMKTRRDGEPN
YDMLVVNPCKRQRTC
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagcggtggaaaacatttggccaaaggttctgccaagcctgaagtacccgatgacggt
aaattatgtttgttctcgatgcgcttctgtccctatgcccatcgagttcacttggtgctg
gatgccaaaaagataccctaccacagtgttttcattaatctgaacgagaaaccagaatgg
ctgactgaatacagccccttgggaaaggtgccagctctgcaattacccaaagaggagggc
tgtccaccgctaatagaatccctggtcattgccgagtatttagatgaaaaatatcccgaa
cctaagctttatcccaccgatccattgaaaaaggcccaagataagattttaattgaacgc
tttaatgccgtcatcggaccaatgtataaaatattcgtaaacaatgaagtttcacccggc
actattactgatgtcagtaatggtttggatattttcgaaaaggaattgcggtcgcgtggc
actgaattctttggtggcgataagcccggcatgttggactatatgatttggccatggtgc
gaacgttcggccatgttgaaatatcttttgagcgataaatatgaaatggataaggaacgt
tttgagaagttgcttaaatggcgtgatctgatggaaaaggacgaggccgtgaaatgtttc
tatttggatggcgagacacatgccaagttcatgaagactcgtcgtgatggtgaacccaac
tatgatatgcttgttgtaaatccctgtaaacgtcaacgcacttgctaa

DBGET integrated database retrieval system