KEGG   Musca domestica (house fly): 101892103Help
Entry
101892103         CDS       T03448                                 

Definition
(RefSeq) uncharacterized protein LOC101892103
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
mde  Musca domestica (house fly)
Pathway
mde00562  Inositol phosphate metabolism
mde01100  Metabolic pathways
mde04068  FoxO signaling pathway
mde04070  Phosphatidylinositol signaling system
mde04140  Autophagy - animal
mde04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101892103
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101892103
   04070 Phosphatidylinositol signaling system
    101892103
   04150 mTOR signaling pathway
    101892103
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101892103
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mde01009]
    101892103
Enzymes [BR:mde01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     101892103
    3.1.3.48  protein-tyrosine-phosphatase
     101892103
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     101892103
Protein phosphatases and associated proteins [BR:mde01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    101892103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase PTPlike_phytase Y_phosphatase3 DSPn
Motif
Other DBs
NCBI-GeneID: 101892103
NCBI-ProteinID: XP_005183453
UniProt: A0A1I8MDR5
LinkDB All DBs
Position
Unknown
AA seq 1325 aa AA seqDB search
MANTLSVMTNVLRNVVSKQRIRYKEKGFNLDLAYVCDNIIAMGYPAEKYESMYRNRLEDV
QKFLEENHRDHYKIYNLCLERSYDISKFHGRVSVYPFEDHNPPTIELIQQFCEDVDSWLK
ADPLNVAAVHCKAGKGRTGTMICCYLLYSGQQRTADDALACYDEKRTKDRKGVTIPSQRR
YVQYFSKLIRMGLSYCRRSLQFCEIRFLGANALQSQGSVHCTISVLEDKVKPLAYYVVDF
RKQSVLDVKITVSGDIKVELTKNTKKLFHFWFNTFFVTDSVIEGDGNDEKYIYTLNKCEI
DDAHKDKEHKCFSEDFKVVLVFYVDGSNAVRDGEKSSSGQSFANHRQSVQSGPANTCLPT
IQSNNYSLPQNNSSGSEMNFICDQQSSSSTSVSSSLGGATTDNSNGYESNSKRNTQHRSG
VQNFGNIHHSHPYVAMHDENSVSYASPPPQPVATIGAPPGYVVEHERLQAKNQHCIQKNN
MHHLQQKHVPSVTATSTPNQRHIQRQNAGTVAGSNADGSGILDIHRGGTDISCPTSANLN
ASGISSSANYNHSTHNSSKTSSVSSQSSSVVGDNEEDWESGESSAKQLDHITLLLSTSSV
TSSPAPKQILPNNNTNTNLSPNDSSRSKQKINVGLQPSSSTSSSSSTSASSSTCTSASQS
SISSKSSSQCPYNKCNTSSSSCINRVAGGDDDDDNENVDESKPKFKISDSNIVATQEQEQ
QLGSAIGATGVSLESGVRDVKKTNTARMPECCDRNSNALTLSTPAQTPSSRPKFMHLLML
PKNNNSHQSTHKPIFKRKSSYKLTKNVSNTTGLNASNDGCRSSTADTTSLESASVTPDTV
LGNMGGVATTSKQKLKIKLKKNKLKFSQKFQWFRSYFRSDPVDFCENFVQQTTSIRRNSI
CSMASRTHKLSTTTPPSITPPPPPLAGANIDGSSSCEQLNDRGPGSVSGSTSNASIATGD
HCEDYYSHICDNQLSFSNSPCKSPRSMADIVGSISGSGGGHGGSFGSSFAHSAGSFHQQY
FRERQETLPGLSSHSARRNNVVIVAAKPVRTNAIGFNIHTATCDDQQSQAVRQDSPDFNA
SPASVYNTASCSPPLTDECVADSQKETKNIPFVFPVNVPNKAPENSSGDSPSKESPTKTQ
TKYSLNLVIVKECPSDECAATAPGNISKTSRRDGEICHDPYSDFSCEQDRNEFTIMHTSN
EGDISGPNATSTAIDDLFETKTTATTSASICSNSSSSGFCTSECCTTNSSSSSCNCNPFA
LGLERHVALAALNTAKQADPKQDIILEVEVEHNDTALTTDPSMPPGNPADEASHIKPESN
EHKCD
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atggccaatactctttccgtcatgacaaacgtattgagaaatgtggtcagcaagcagcgt
attcgctacaaggagaaaggtttcaatttggatttggcctatgtatgtgataacattatt
gcaatgggatacccggcggaaaaatacgaaagcatgtatcgaaaccggttagaagatgtt
caaaagtttctagaggaaaatcatcgagatcactataaaatctacaatctatgtctggaa
cgcagctatgatattagcaaatttcacgggcgagtttcagtttatccatttgaggaccat
aacccacccacaatcgaactgatacaacaattttgtgaagatgttgactcttggcttaag
gcagatcctcttaatgtggctgctgtacactgtaaagctggcaaaggtcgtacgggaact
atgatctgctgctatttactctatagtggacaacaacgtaccgcggacgatgctttggcc
tgctatgacgaaaaacgaacaaaggatcgtaagggagttacgataccatcgcagagacgc
tatgtgcagtatttctccaaactgatacgcatgggattatcatattgccgtcgttcactg
caattctgtgaaattcgatttttgggggccaatgcattacaaagtcaaggctctgtacat
tgcacaatttctgttttagaggataaagtaaagccattggcatattatgtcgtagatttt
cgtaaacagagtgtactcgatgtgaaaataacagtttccggcgatataaaagtcgaatta
acgaaaaacaccaaaaaattatttcatttctggtttaatacgttctttgtaacagattca
gttattgaaggagacggcaatgatgagaaatacatatacactctaaacaagtgtgaaatc
gatgatgcgcacaaggataaagagcataaatgtttctccgaagatttcaaggtggtactt
gttttctacgtcgacggaagtaatgctgtgcgagatggggaaaaatcttcgagcggacag
agcttcgcaaatcatcgtcagtctgtgcagagtggaccggcaaacacctgtttgccgaca
atacaatcaaataattactcattaccacagaataacagcagcggcagtgaaatgaacttt
atatgtgatcagcaatcatcatcctctacgtcggtgagcagcagcttaggtggtgccacc
accgacaacagcaatggttatgaatcgaattcgaagcggaacacgcagcatagaagtggc
gttcaaaacttcggtaatattcatcattctcatccttatgtggctatgcacgatgaaaac
agtgtttcgtatgcatcgccaccaccacagccggttgcaacaattggagcaccacccggc
tatgttgtagaacatgaacgtctacaggcgaaaaatcagcactgcatacagaaaaataac
atgcaccacttgcagcaaaaacatgtgccgtcagtgactgccacttcaacgccaaaccag
aggcatatacaaagacaaaatgctggcaccgttgctggcagcaatgctgacggaagtggg
atactggatatccatagaggtggcacggatatatcgtgtccaacgtcggcaaatttaaat
gccagtggcatcagcagtagcgccaattacaaccacagtacccataacagtagcaaaacc
agcagcgtcagcagccaatcgtcttctgtagtcggagacaacgaggaggactgggaatcc
ggtgagtccagtgctaaacagcttgatcacattactttattactttctacttcttctgta
acatcttctcctgctccgaaacaaatacttccaaataacaatacaaataccaatttatct
cccaatgattcctcgagaagtaagcaaaagattaatgtcggtcttcagccctcttcctcc
acctcctcctcatcctctacatccgcctctagctctacctgtacctctgcatcccaatca
tctatatcctccaaatcctcttcccaatgcccctacaacaaatgtaacactagcagtagt
agttgtataaatagagttgctggtggtgatgatgatgatgataatgaaaacgtcgatgaa
agtaaacctaaatttaagatatctgactcgaacattgtggccacacaagaacaagagcaa
caattaggaagcgccattggagctacaggggtatcattagagtcaggtgttagggacgtt
aaaaaaaccaacacggctagaatgccagaatgttgtgatcggaatagtaatgcattgacg
ttgtcgacaccggctcaaactcctagtagtcggcccaagtttatgcatctattgatgctc
ccaaaaaacaacaattcacatcagtcgacgcataaaccaattttcaagcgtaaatcgtct
tataagttgacaaaaaatgtgtcgaataccacagggcttaatgcttccaatgatggttgc
aggagttccactgctgatactacatcattggaatcggcttctgtgacacctgatactgtg
ctggggaacatgggtggtgtagccacgacatccaagcagaaactaaaaatcaagcttaaa
aaaaacaaactcaaattttcacaaaaatttcaatggtttcgaagctattttcgcagtgac
cctgtagatttctgtgaaaactttgtgcagcagaccacatcaatacggcgcaacagtatc
tgcagtatggctagtcggacgcacaaattatcgacaacaactccgccttcaataacgccg
ccgccccctcctctagctggagcgaatattgacggctcttcgtcgtgtgaacagttgaac
gaccgaggtcccggtagtgtttcagggtctacatcgaacgccagcatagcaactggcgat
cattgtgaagactactattcacacatttgcgacaatcaattaagctttagtaattctccg
tgcaaaagtccccgatccatggcggacattgttggtagtattagcggcagtggtggtgga
catggtggaagttttggcagcagttttgcccacagtgcaggtagtttccatcaacagtac
tttcgagagcggcaggaaaccttgccgggcctcagttcacacagtgctcgtcgcaacaat
gttgtcattgttgccgctaagcctgtacgtacgaacgctattggctttaacatacacaca
gcgacctgtgacgatcagcaatctcaagcagtgagacaggattcaccagattttaatgcc
tcgccggccagtgtatataacactgctagttgttcgccgccactaactgacgagtgtgtt
gcagatagccagaaggaaaccaaaaacatacccttcgtatttccagtaaatgttcccaac
aaagcgccagaaaattcaagtggtgacagcccgtctaaagaatcacctacaaagacgcaa
acaaagtattctctaaacttggttattgtcaaagaatgtccttctgatgagtgtgctgcc
accgcacccggtaacatatcgaaaacatctcggcgagatggcgaaatatgccatgatcca
tattcggacttttcttgtgaacaagatcgaaacgaattcaccatcatgcatacctccaac
gagggtgacatttcgggaccaaatgcaacatccaccgccatagacgatttgtttgagaca
aagaccactgcaactaccagtgcatccatatgcagtaacagtagcagcagtggcttttgt
acaagcgaatgttgtactacaaacagtagtagcagtagctgtaattgtaacccctttgca
ttaggtttagaaaggcatgtcgccttagctgccctcaacaccgcgaagcaggcggatccg
aagcaggacatcattctggaagttgaggtggagcacaatgacactgcactcaccactgac
ccttccatgcctcctggcaatcccgcagatgaggcttctcatataaagcctgagtccaac
gagcataaatgtgattaa

DBGET integrated database retrieval system