KEGG   Musca domestica (house fly): 101893592
Entry
101893592         CDS       T03448                                 

Definition
(RefSeq) serine protease HTRA2, mitochondrial
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101893592
   04215 Apoptosis - multiple species
    101893592
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mde01002]
    101893592
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mde03110]
    101893592
Enzymes [BR:mde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     101893592
Peptidases and inhibitors [BR:mde01002]
 Serine peptidases
  Family S1: chymotrypsin family
   101893592
Chaperones and folding catalysts [BR:mde03110]
 Other chaperones and cochaperones
  DegP / HtrA
   101893592
SSDB
Motif
Pfam: Trypsin_2 Trypsin PDZ_2 PDZ_6 PDZ Tricorn_PDZ Peptidase_S46 DUF6288
Other DBs
NCBI-GeneID: 101893592
NCBI-ProteinID: XP_005185067
UniProt: A0A1I8M2X9
LinkDB
Position
Unknown
AA seq 422 aa
MALQYLHKFSLTTRRIQSKTIRIVSSSQSHEYSTSNNEHFNGHREREHQQKSSFWSWNSS
LLTTAGCAAIALGGLAYINNEQKLWPAVEAKTLPNLSGRRKQFNFIADVVDVCAESVVYI
EIKDTRHFDYFTGKPVTASNGSGFIIESDGTILTNAHVVINKPHTMVQVRLHDGRVFPAV
VEDVDQTSDLAIIRINCKNLPVMKLGESSSLRSGEWVVALGSPLALSNTVTAGVISSTQR
PSQELGLGNRDINYLQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKL
FLAKVAERRKKGSGGKQTYPAKRYMGITMLTLTYDILNELKSRSDSVPSNLTHGVLVWKV
ILGSPAHIGGLNPGDIVTHINGKEIKTSSDVYEVLADNSKTLDLTIFRGLKRMTVSISPE
DP
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggctttgcaatatttacataaattctctttaacaacgagaagaatacaaagcaagaca
atccggatagtatcatcatcacagagtcatgaatattccacaagtaataatgaacatttt
aacggtcaccgggaaagagaacaccagcaaaaatcatcattttggtcatggaacagttca
ctgctgacgacagccggttgtgctgccattgctctgggaggtttagcttacattaacaac
gaacaaaagttgtggcccgcagtggaggccaagacgttacccaatttaagtggcagacgt
aagcagttcaattttattgccgacgtggtggatgtttgtgccgaatccgttgtatacatt
gagataaaagatacacgacatttcgattacttcacggggaagccggtaacagcttctaat
ggctcaggtttcattattgagtcggatggaactattctcaccaatgctcatgtggtaatc
aataaaccccataccatggttcaggttcgtttgcatgatggacgtgttttccccgccgta
gtggaagatgttgatcagacctccgatttggcaatcatacgcatcaattgcaaaaatttg
cctgttatgaaattgggagagagctccagtttacgttccggtgaatgggttgttgccctc
ggtagtccgcttgctttaagtaacacagtaactgccggtgtaataagttccacgcagcgt
ccttcccaagaattgggtttaggaaatcgggatataaattatttgcaaactgatgcggcc
attacattcggcaatagtggtggtcccctggtgaatttggatggcgaagcgataggtgtt
aattctatgaaagtgacagcaggcatcagtttcgccatacccattgactatgttaaactg
ttcctggccaaagtggcggaacggaggaaaaaaggctcgggtggtaaacaaacatatcct
gccaaacgttacatgggcattacaatgctaacgttgacctatgatattcttaatgagttg
aagtcaagatctgatagcgtaccatcgaatctaacgcatggagttttggtatggaaagtt
attttgggatctccagctcatattggcggtttgaatcccggcgacattgtaacgcacatc
aatggcaaggaaatcaaaacctcctctgatgtctatgaagtattggctgacaattcaaaa
acattggacctaaccatctttagaggacttaagcgtatgactgtgtcaatttcaccagaa
gacccttag

DBGET integrated database retrieval system