KEGG   Musca domestica (house fly): 101894748
Entry
101894748         CDS       T03448                                 

Definition
(RefSeq) cell death protein hid
  KO
K20016  cell death protein hid
Organism
mde  Musca domestica (house fly)
Pathway
mde04013  MAPK signaling pathway - fly
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    101894748
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101894748
   04215 Apoptosis - multiple species
    101894748
SSDB
Other DBs
NCBI-GeneID: 101894748
NCBI-ProteinID: XP_005180529
UniProt: A0A1I8MSN3
LinkDB
Position
Unknown
AA seq 310 aa
MAVPFYLPEGGADDTVSSGGNTSSDGTNSTASSLQASPNTTSSATQTPMQSPLVPGMMMA
LYEALYRYSVNSGAPVFQYPPPPSPSCSVHSPNYTGGDVFFPRSRSTPRTPRTSVSFAAG
DEVNFFHQSAPTCSSSAQTSQAPQSAPPVSSHQYLPPHQQHYPHYPHFAYHHNGPGYYQY
TPPPTPTTANATTSTAAAGLSVSSGPNGAHRSLHRSLSDTARRSRLTSTGEDEREYQSEH
ETSWDEFDDRYDNFTAGRERLQEFNGRIPPRKKKKDVPKPKPEKKEQSFTWPAVVTVFVF
AMGCGFLVAR
NT seq 933 nt   +upstreamnt  +downstreamnt
atggctgtgcccttctatttgccagagggtggtgccgatgacacggtctcatctggtggc
aacacctcctcggatggcaccaacagtaccgccagttcattgcaagcttcgccaaatacc
acctcatcagccacacaaacgccaatgcagagtcctttggtaccgggaatgatgatggca
ctgtacgaggcgttgtatcgctattcggttaacagtggtgctccagttttccaatatccc
ccaccacccagtccctcctgctccgttcacagtcccaattacacgggcggtgatgtcttc
tttccacgcagtcgcagcacaccacgtacaccccgcacaagtgtcagctttgctgccggt
gatgaggtgaattttttccatcaatccgcaccgacttgctccagttcagcccaaacatca
caggcaccccagtcagcgccaccagtcagtagtcatcagtatctgccaccgcatcaacag
cattatcctcattatccacattttgcctatcatcacaacggtccgggctattatcaatat
acacctccgcccacacccaccactgccaatgccacgacatcaacagcggcggcaggtttg
tcggtgagctcaggacccaatggtgcccacagaagtctacatcgaagcctatcagataca
gccagacgatcacgtttgacctcgacgggtgaagatgaacgtgaatatcagagtgaacat
gaaacgagttgggatgagttcgatgatcgttatgacaactttacagccgggcgagagcgc
ctgcaggagttcaatggcagaataccgccacgtaagaagaaaaaggatgtgccaaaaccg
aaaccggaaaagaaggaacaaagctttacatggcccgctgttgtaactgtctttgtgttt
gccatgggttgtggttttcttgtggcccgatga

DBGET integrated database retrieval system