KEGG   Musca domestica (house fly): 101895212Help
Entry
101895212         CDS       T03448                                 

Definition
(RefSeq) maltase A3
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mde  Musca domestica (house fly)
Pathway
mde00052  Galactose metabolism
mde00500  Starch and sucrose metabolism
mde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101895212
   00500 Starch and sucrose metabolism
    101895212
Enzymes [BR:mde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101895212
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF4635
Motif
Other DBs
NCBI-GeneID: 101895212
NCBI-ProteinID: XP_005186320
UniProt: A0A1I8MLG8
LinkDB All DBs
Position
Unknown
AA seq 584 aa AA seqDB search
MAKWTTYCWCSLVVLLGLCLTRTQVEAKEWWETASFYQIYPRSFKDSDGDGVGDLKGVTS
KLAYLKEIGMAATWLSPFLKSPMADFGYDISNFTEVDPLFGTMDDFEDMMKKSKELGVRI
ILDFVPNHSSDECEWFIKSAARDPEYKDYYIWHPGKIVNGSRTVPNNWVSVFRGSAWEWH
EGRQEYYLHQFHKKQPDFNFRNPKVREAMNEILRFWLRKGIDGFRVDAIYHAFEVAPDAE
GNYPDEPRNDWTDDPDDYGYLHHIYTVDQPETPHLVYEWRKLLDDFRKENGGDERILMVE
TWSPINIVMEYYGNATADGAQIPFNFQMISYLWNDSDAYHYDNLINEWLKLMPAGRTANW
VVGNHDKNRVGTRFGADRIDMFNMLLLTLPGCSITYNGEEIGMTDVWISWEETVDPQACN
GHEDGYEYRSRDPARTPFQWSDEKNSGFSDGDKTWLPVSPNYKMENLKRQRGIARSHLNV
FKELQNLRHEETLREGSTEVKAFSHDVLGIKRSLANDYTYITLMNIFDSQQVVNLNDAFK
NLPAEFEYVVLSDKSIRRKGDKVASSRIELLPKEAVVLRSIVKV
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagtggacgacatattgctggtgctctctagtggttctgctgggactttgcctt
acccgaactcaagtggaagccaaggaatggtgggaaacggcctcgttctatcaaatctat
ccacgatcctttaaggacagcgatggcgatggtgtgggcgatctgaagggcgtgaccagt
aaattggcctatctgaaagagattggcatggctgccacatggctatcgccatttttaaaa
tctcccatggctgattttggttatgacatctcgaatttcaccgaagttgatccgctcttt
ggtaccatggatgattttgaagatatgatgaaaaaatcgaaagagctaggtgttcgcatt
attttggattttgtacccaaccactcgagtgatgagtgtgaatggtttatcaaatccgcg
gccagagatcccgaatataaagattattatatctggcatccagggaaaattgtcaatggt
agccggacggtgccaaataattgggtgagtgttttccgtggctccgcctgggaatggcat
gagggtagacaggaatactatctgcatcagttccacaaaaagcaaccggattttaatttt
cgcaatcccaaagtgcgagaggcaatgaatgaaattttacgtttctggttacgcaagggc
attgatggcttccgtgtcgatgccatttaccatgcctttgaggtggcgcccgatgccgag
ggcaattatccagatgagccccgtaatgattggaccgatgatcccgatgattatggttat
ctccatcatatctacaccgtggatcaacctgaaactccccatttggtctatgaatggcgc
aagctcttggatgatttccgtaaggaaaatggtggagatgagagaatcctcatggtggag
acctggtcccccatcaacattgtcatggagtattatggcaatgccacagccgacggtgcc
cagatccctttcaatttccaaatgatcagttatttgtggaatgattcagatgcctatcat
tatgacaacctcatcaacgaatggctaaaactgatgccggcgggacgtacggccaactgg
gtggtgggtaatcatgataagaatcgtgtgggtacaagattcggagccgatcgcattgat
atgttcaatatgttgctgctcaccctgcccggttgtagcataacctataatggcgaggag
attggcatgacagatgtttggatttcatgggaggagacagtggatcctcaggcatgtaat
ggccatgaggatggctatgagtatagatcccgagatccggcacgcacacccttccagtgg
agtgatgagaaaaattcaggattttcagatggcgataagacctggttgcccgtcagtccc
aattataaaatggagaatctgaaaaggcagcggggtattgcccgtagtcatttgaatgtt
ttcaaggaactgcagaatctaaggcatgaggagacgctcagagagggttcaacggaggtc
aaggcctttagccatgatgtgttgggtattaaacgctccctggccaatgactacacctac
attaccctcatgaacattttcgattcccagcaagtggtgaacctaaacgatgcctttaag
aacctacccgctgaatttgaatatgttgtcctcagcgacaagtcaattcgtcgcaagggc
gataaagtggccagcagtcgaattgagttgctacccaaagaagctgtggttttgaggtca
attgttaaagtctaa

DBGET integrated database retrieval system