KEGG   Musca domestica (house fly): 101895561Help
Entry
101895561         CDS       T03448                                 

Definition
(RefSeq) maltase A2
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mde  Musca domestica (house fly)
Pathway
mde00052  Galactose metabolism
mde00500  Starch and sucrose metabolism
mde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101895561
   00500 Starch and sucrose metabolism
    101895561
Enzymes [BR:mde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101895561
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 101895561
NCBI-ProteinID: XP_005186322
UniProt: A0A1I8MZJ5
LinkDB All DBs
Position
Unknown
AA seq 567 aa AA seqDB search
MKSRVAGLTLLALLVLGATAAQVDWWENASLYQIYPRSFQDSDGDGVGDLKGITSRLEYL
KEIGITATWLSPVFESPMSDFGYDISNFTRIDPIFGTLEDFDAMIAKAKQLGVKIILDFV
PNHSSDECEWFKKSIKREKGFEDFYVWDDGKVDPQDNTKRLPPSNWVSVFGGSQWTWNAE
RQQFYLHQFQDKQPDLNFSNPLVRQHMLDVLKYWLDRGVDGFRIDAVPHIFEKRNDDGSF
PDEPVSGGSSDPNSYDYHDHIYTKDQYPTVELLYEWREFLDSYRAKNGGDTRILLAEAYS
SVETLSLYFGNGTHSGAHIPMNFNLMYLNGFSTAQDVENSANYWMDTMWKQHQAANWVVG
NHDNGRVANRMGRHKVDLLNIIVNCLPGASVTYYGEEIGMSNVATQCTAVSCDDRDPERT
PMQWEPLPNVGFTNGPSTWLPIAEDFETYNVQTERMVARSTLNIFKGLQQLKYTAAFRNF
KSAGGFSYKALSEQVLQIIRSSPGREEYMILINMGNKMEHVENLSSLTYEYVLLSPHSPH
NVGDKANLLGRLYLMPYEAVVLRWLER
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccagagtagccggtctgacgctgctagccctactggtgttgggcgccacagct
gcccaagtggattggtgggaaaatgcctcgctttatcaaatctatcctcgttcctttcag
gacagcgatggtgatggtgtgggcgatttgaagggtattacctcgcgcctggaatatttg
aaggaaattggcattactgccacatggctgtcgccagtctttgaatcgcccatgtccgac
tttggttatgacatatccaattttacccgcattgatccgatttttggtaccctggaagat
ttcgatgccatgattgccaaggccaagcaactgggtgtgaaaattattttggattttgtg
cccaatcactcgagtgatgaatgtgaatggttcaagaaatccataaaaagggagaagggt
tttgaggatttctatgtgtgggatgatggcaaggtcgatcctcaggataatacaaaaaga
ttgccgccaagcaattgggtctctgtctttggtggctcccaatggacctggaacgccgag
cgccaacaattctatctgcatcagttccaggacaaacaacctgacttgaatttctccaat
cccctggtacgccagcatatgttggatgttttgaaatattggcttgatcgtggcgttgat
ggtttccgcattgatgccgtgccccacatctttgagaagcgcaacgatgatggctccttc
cccgatgaacccgtgtctggtgggtcctctgacccaaatagttatgattatcatgatcac
atctataccaaggatcaatatcccaccgtggaattgctgtacgaatggagggaatttttg
gactcatatcgggcgaagaatgggggagatacaagaatcctcttggccgaagcctactcc
tcggtggaaacccttagcctttactttggcaatggtacccactctggcgcccatataccc
atgaatttcaatctgatgtatttgaatggtttctcaacggcccaggatgtggaaaattcc
gccaactattggatggacacaatgtggaaacaacatcaggcggccaattgggtggtgggt
aatcatgacaatgggcgtgtggccaatcgtatgggtcgccacaaggtggatttactgaat
attattgtcaattgtctgccaggggcctcggtcacctattatggtgaggaaattggtatg
tccaatgtggccacccaatgtacggctgtgtcctgtgacgatcgtgatcctgagcgcaca
cccatgcaatgggaacccctgcccaatgttggctttacaaatggtccgagcacatggctg
cccattgccgaggactttgaaacctataatgtccaaacggaacgtatggtggcccgtagc
accctgaatattttcaagggcctacagcaacttaaatatacggcggcttttcgcaatttc
aagtcggccggtggtttttcctacaaggccttgtccgaacaagttttgcaaatcatacgc
tcttcaccgggccgcgaagaatatatgattttgataaatatgggtaataaaatggaacat
gtggagaatttgagctcgctcacctatgaatatgttttattgagtccccattcgccacac
aatgttggcgataaggcgaatttgcttggccgcttgtatttaatgccctacgaagctgtg
gtcttgcgctggttggaacgataa

DBGET integrated database retrieval system