KEGG   Musca domestica (house fly): 101896030
Entry
101896030         CDS       T03448                                 

Definition
(RefSeq) fas-associated death domain protein
  KO
K02373  FAS-associated death domain protein
Organism
mde  Musca domestica (house fly)
Pathway
mde04215  Apoptosis - multiple species
mde04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    101896030
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    101896030
SSDB
Motif
Pfam: Death DED Peptidase_M13_N
Other DBs
NCBI-GeneID: 101896030
NCBI-ProteinID: XP_005190084
UniProt: A0A1I8NBE9
LinkDB
Position
Unknown
AA seq 253 aa
MAQHWSYDILKHIAINDKDAQDNLEDLKSILLDDIGSTRNMCRIKDMTDLIDCLERHDAL
SENNIEPLREIADQFGNKELEEAICNYFAPKDSSGFTEPYNQYKELRLADEVRSHLSING
DSQHAEVRGRMSNDNVRFQSGQSQTLPPPLPTPTIYPQELTDRKRAAIHKLIANEIGKFW
RALGRELQLSQGQLDALEMEYPRDLVSRVYKLLQVFEEDECHDSKQNVLVLCRALEDCRR
KDLRRKVEDIMSH
NT seq 762 nt   +upstreamnt  +downstreamnt
atggcccagcattggtcgtatgatattctgaagcatatagctatcaatgacaaggatgct
caagacaatttggaagacttgaaatcaatcctgctagatgatattggatcgactaggaat
atgtgtcgtattaaggatatgacagatctcatagattgtttggaaagacatgatgccttg
tccgaaaacaatattgaaccactgcgagaaattgcggatcaattcggaaacaaagaactt
gaggaagcaatttgcaattattttgcaccaaaagactcgtcgggcttcacagaaccttac
aaccaatacaaggaacttcgtttggccgacgaagtaagaagtcacttgagtatcaatggc
gattcacaacacgcagaggttcgtggaagaatgtccaacgataatgtacgtttccaaagt
ggacaaagccaaactctccctccccctctaccaactccaactatttatcctcaagaattg
acggataggaagcgtgctgcaatccataaactaatagctaatgaaatcgggaaattctgg
agagctttgggaagggaattacaactttcacaaggtcaattggatgccttagaaatggag
taccctcgggatttagtttctcgggtatacaagttgttgcaggtgtttgaggaggatgag
tgccacgattccaagcaaaatgttcttgtattgtgtagagctttggaagactgccgacgt
aaagacttgcgtagaaaagtcgaagatataatgtcacactaa

DBGET integrated database retrieval system