KEGG   Musca domestica (house fly): 101896241
Entry
101896241         CDS       T03448                                 

Definition
(RefSeq) septin-2 isoform X1
  KO
K16943  septin 4
Organism
mde  Musca domestica (house fly)
Pathway
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    101896241
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mde04131]
    101896241
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mde04812]
    101896241
Membrane trafficking [BR:mde04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    101896241
Cytoskeleton proteins [BR:mde04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     101896241
SSDB
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase GTP_EFTU AIG1 Ras AAA_22 ABC_tran AAA_16 Pox_A32 IIGP VirE Roc AAA_29 AAA_7
Other DBs
NCBI-GeneID: 101896241
NCBI-ProteinID: XP_005186906
UniProt: A0A1I8MBF4
LinkDB
Position
Unknown
AA seq 459 aa
MDHGITLHRQQNTGSGSILNKSYSVNIANGNNNIANSNTSTTTSSSSSSINQQHLNTNHN
NNTPISGLGSGGGLSSKYKPPLYPKPKTPSFDKDRDYIGFATLPEQVHRKSVKRGFEFTL
MVVGESGLGKSTLINSLFLGDMYKNRVIPPVEERIEKTTRIEKKTMDIEERGVRLRLTVV
DTPGFGDSVNCEDSWRVCTAYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSL
RQMDLDLLRRLHRKVNIVLVIGKADCLTKTEVRNLKERILRDLEDNHIQLYQFPECDSDE
DEDFKQQDRELKASIPFAVVGSNVILDIAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFL
ISTHMQDLKDTTQDVHYENFRAQCISQISQHALRERGKLKRDSISSTNGFEAAITETDRL
LLQKDEEIRRMQDMLTQMQEKLKQTHLMEMKKNDSVIDV
NT seq 1380 nt   +upstreamnt  +downstreamnt
atggatcatggcattacgttgcatcgccaacagaataccggcagtggtagcattctgaat
aaatcctacagcgttaatatagccaatggtaataacaacatcgccaattctaatacatca
acaactacatcatcgtcatcatcatcgataaatcaacagcatttgaatacaaatcacaac
aacaatacaccaattagcggactgggcagcggcggtggtctgagcagcaaatataagccg
ccattgtatccgaaacctaaaacaccatctttcgacaaggatcgtgactatataggtttt
gccacgctgccggaacaggtccatcgtaaatcggtaaagcgtggttttgaatttaccctc
atggttgtaggagagtcgggtttgggcaaatcgaccctgatcaatagtctcttcttgggt
gatatgtacaagaatcgggttataccacccgtcgaggaacgcattgagaagacgacacgc
atcgaaaagaaaaccatggacatcgaggagagaggggtacgtttgcggctaacggtagta
gatacacccggttttggcgattcggtgaattgtgaagacagctggagggtgtgcacggcc
tacatcgatgaacagttccgtcaatatttcaccgatgaaagtggtttgaatcgacgcaac
attcaggataatcgggtccattgctgtttatattttgtacctccatggggtcatagttta
cgtcaaatggatttggatctgctgcgacgcttgcatcgcaaagtcaacattgtgctggtc
attggcaaagccgattgtttaaccaaaaccgaggtacgcaatctaaaggaacggatactg
cgcgatctcgaagataatcacatacagctgtatcagtttcccgaatgcgattccgatgag
gatgaagatttcaagcagcaagatcgggagctgaaggcttccatcccctttgcggtggtc
ggcagtaatgtcatcttggacattgcgggcaaaaaggtacgcggccgccaatatccctgg
ggtgtggtcaacgttgaggatccggaacatagtgatttcatcaaactacgcaccttcctc
atctccacgcatatgcaagacttaaaagacaccacccaagatgtccactatgagaatttc
cgggctcaatgtatttcgcagatatcgcaacatgccctgcgtgaacggggtaaattgaag
cgtgattcgattagttcaacaaatggttttgaagctgccatcacggaaacggatcgtctg
ctgctgcaaaaggacgaggagattcgtcgcatgcaggatatgctgacacagatgcaggag
aaactgaaacagacgcatctcatggagatgaaaaagaacgacagtgtcatagatgtttag

DBGET integrated database retrieval system