KEGG   Musca domestica (house fly): 101896705
Entry
101896705         CDS       T03448                                 

Definition
(RefSeq) stress-activated protein kinase JNK-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mde  Musca domestica (house fly)
Pathway
mde04013  MAPK signaling pathway - fly
mde04068  FoxO signaling pathway
mde04137  Mitophagy - animal
mde04140  Autophagy - animal
mde04141  Protein processing in endoplasmic reticulum
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
mde04310  Wnt signaling pathway
mde04391  Hippo signaling pathway - fly
mde04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:mde00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101896705
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    101896705
   04310 Wnt signaling pathway
    101896705
   04391 Hippo signaling pathway - fly
    101896705
   04068 FoxO signaling pathway
    101896705
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101896705
   04137 Mitophagy - animal
    101896705
  09143 Cell growth and death
   04214 Apoptosis - fly
    101896705
   04215 Apoptosis - multiple species
    101896705
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    101896705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mde01001]
    101896705
Enzymes [BR:mde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101896705
Protein kinases [BR:mde01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101896705
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH Kinase-like
Other DBs
NCBI-GeneID: 101896705
NCBI-ProteinID: XP_005183406
UniProt: A0A1I8NDP7
LinkDB
Position
Unknown
AA seq 371 aa
MTNLPHKDFYTVEVGDTNFTVPIRYQNISPIGMGAQGIVCSALDATTKTNVAIKKLSKPF
QNVVQAKRAYRELKLMKLVNHKNIIGLLDVFTPSESLDEFQDMYLVMELMDANLSAVVGI
GLDHNRLSYLIYQILCGIRHLHSAGIIHRDLKPSNICVNANCSLKILDFGLARTAAEPTF
LMTPYVVTRYYRAPEIILGMPYKENVDIWSVGCIMGELIRGGVLFKGSDHLDQWMKIIQQ
IGSPDKSFFADLVPNVRQYIENLTQYEGYSIERLFPDALFHVDEENGDEEDEDEYQRNTD
NARDLLARMLTIDPKHRISIDEALNHRYINVWYEQEEVDAPIPQICSLDVDERGHSIAEW
KKIIYDEIKNA
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgaccaacttaccccacaaggatttctatacggtggaagtgggcgacaccaattttaca
gtgccaattcgttatcaaaatatttcgcccattggcatgggagctcaagggattgtgtgc
tcagctttggacgccaccacgaaaaccaatgttgccattaaaaaactatcgaaacccttt
caaaatgttgtacaggccaagcgggcgtatcgtgaattgaagctcatgaaactggtcaat
cacaagaacatcattggcctcctggatgtgttcacgcccagcgaaagtttggatgaattt
caagatatgtatttggtaatggaactaatggatgcaaatctcagtgccgttgtggggatt
ggtttggatcacaatcgtctctcgtatctgatatatcaaatactatgcggcattcgccat
ctccattcggctgggataatacatcgggatctgaaaccctccaacatttgtgtgaatgcc
aattgttcgttgaaaattctcgatttcggtttggcacgcacggcagcggaaccgactttc
ctaatgactccatatgtggtgacacgttactatcgagctccggaaattattctcggtatg
ccgtacaaggaaaatgttgacatttggtcggtgggctgtatcatgggtgagctgatacgt
ggcggggttctgttcaaaggctccgatcatttggatcaatggatgaaaatcatccaacaa
atcggcagtccagataaaagttttttcgccgacttagtaccgaatgttcgacaatatatt
gaaaatttgacccagtatgaaggatattctattgaacgtttatttcccgatgctttattc
catgtggatgaggaaaatggcgacgaagaggatgaagatgaatatcaaagaaacacagat
aatgcccgagatttattggctcgtatgctaaccattgatccaaagcatcgcatttcgata
gatgaggccttgaaccatagatatattaatgtttggtacgaacaggaggaggtcgatgca
cccataccacaaatttgtagtctggatgtcgatgaaaggggtcacagcattgcggagtgg
aagaaaatcatttatgacgaaataaaaaatgcatga

KEGG   Musca domestica (house fly): 101900990
Entry
101900990         CDS       T03448                                 

Definition
(RefSeq) stress-activated protein kinase JNK
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mde  Musca domestica (house fly)
Pathway
mde04013  MAPK signaling pathway - fly
mde04068  FoxO signaling pathway
mde04137  Mitophagy - animal
mde04140  Autophagy - animal
mde04141  Protein processing in endoplasmic reticulum
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
mde04310  Wnt signaling pathway
mde04391  Hippo signaling pathway - fly
mde04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:mde00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101900990
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    101900990
   04310 Wnt signaling pathway
    101900990
   04391 Hippo signaling pathway - fly
    101900990
   04068 FoxO signaling pathway
    101900990
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101900990
   04137 Mitophagy - animal
    101900990
  09143 Cell growth and death
   04214 Apoptosis - fly
    101900990
   04215 Apoptosis - multiple species
    101900990
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    101900990
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mde01001]
    101900990
Enzymes [BR:mde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101900990
Protein kinases [BR:mde01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101900990
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 RIO1 Kinase-like APH
Other DBs
NCBI-GeneID: 101900990
NCBI-ProteinID: XP_005191399
UniProt: T1P976
LinkDB
Position
Unknown
AA seq 380 aa
MSSHPSRRDFYTVEVGDTNFTILTRYQNLRPIGSGAQGIVCAAYDTVTEQNVAIKKLSRP
FQNVTHTKRAYREFKLMKLVNHKNIIGLLNAFTPQRSLEEFQDVYLVMELMDANLCQVIQ
MDLDHDRMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKADCTLKILDFGLARTAGTTF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQ
LGTPSTSFMQRLQPTVRNYVENRPRYSGYSFDRLFPDVLFPSDNNEQSRRKAAEARDLLS
KMLVIDPEQRISVEKALLHSYIHVWYDNEEVNAPAPEPYDHSVDEREHNVEQWKELIYEE
VMDYEAHTSNNTNAGSNNTR
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgagttcccatccttcccgtcgcgacttctatacggttgaagtgggtgacaccaatttt
acaatactcacccgttaccagaatctacggcccattggttccggagcgcagggaattgtt
tgtgctgcctatgacactgtgaccgaacagaatgttgccataaaaaagttgtctcgtcca
ttccaaaatgtaacacataccaaaagagcttatcgcgagtttaagctcatgaaattagta
aatcataagaatatcattggattacttaatgcatttacgccccagcgcagcttggaagag
ttccaagatgtctatctggtcatggagctgatggatgcgaatctgtgtcaggtcattcaa
atggatttggatcatgaccgtatgtcctatctgctgtatcaaatgctgtgcggcatcaag
catttgcattcggccggtatcatacacagggatctgaagccgtcaaacattgtcgtcaag
gcagattgtacattgaagatattggattttggtttggcaagaacagcgggcacaacattc
atgatgaccccatatgttgtgacgcgctactatcgtgcacccgaagtcattttgggcatg
ggctacaaagagaatgtcgatatatggtctgttggctgcatcatgggcgagatgatacgt
ggtggtgtcttgttccccggtaccgatcacattgatcagtggaataagatcattgagcag
ctgggtacaccatcgaccagttttatgcagcgtttgcaaccaactgtgcgcaactatgtc
gagaacaggccacgatattcaggatattcatttgaccgtctatttccggatgtattgttt
cctagcgacaacaatgaacagagtcgacgaaaggcagctgaggcccgtgatttgctaagc
aagatgttggtaattgatccggagcaacgtatatcggtggagaaggctttgctacacagc
tacattcatgtttggtatgacaatgaggaggtgaatgccccagcacccgaaccctatgat
cacagcgtcgatgagagggaacacaatgttgagcaatggaaggaactgatctatgaagaa
gtcatggactacgaggcccatacaagtaataataccaatgctggttccaataatacccgg
tag

DBGET integrated database retrieval system