KEGG   Musca domestica (house fly): 101896806
Entry
101896806         CDS       T03448                                 

Definition
(RefSeq) caspase Dronc
  KO
K20009  caspase Dronc [EC:3.4.22.-]
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101896806
   04215 Apoptosis - multiple species
    101896806
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mde01002]
    101896806
Enzymes [BR:mde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     101896806
Peptidases and inhibitors [BR:mde01002]
 Cysteine peptidases
  Family C14: caspase family
   101896806
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 101896806
NCBI-ProteinID: XP_005178429
UniProt: A0A1I8M0I9
LinkDB
Position
Unknown
AA seq 454 aa
MDDEHRKLIEKSIDRLITCTKFDELSHACFTMNLLSKVMLQKINRVPENQMQLSDAEKQV
ERHRRLFKKITQRGPDAFNKLCDICAALHYDTALGILRPDRYVSIKSNKMAISSGSMNHC
QQNANYINNNTSSNNNDDSRRSSISIDDDEDNGDGAYQQTDRRRSSSKTLDSVSVLQEYT
GEICPKDKFEVKRAARILKHPSLDTYPMQSKENRGVFFMVNMINFPVETHRRDGADEDTH
SLLYLFKQLGFKLFSYTNLSHEVFFDILGKLLKSDYTKNTECFVMALMTHGDMDDSVQRI
TFSDGSVVKVKDIEDYFNHHVCENLVNKPKIFLFPFCRGDMLEHGVINKVQTDSIQYNTH
RIKNIPILSDLIVCYATSEGFKAHRDPADGSWYIQSFVKNMAKNAHDTSFEDILKNIQAD
TLKLRTIDGSLQTANYVNRGFNKALYFNPRIWLE
NT seq 1365 nt   +upstreamnt  +downstreamnt
atggatgatgaacaccgtaaacttattgaaaaaagcattgatcgcttaataacatgtaca
aaatttgatgaattatcccacgcctgtttcactatgaatctgttgtcaaaagtaatgtta
cagaaaattaatcgtgttccagaaaatcaaatgcaattatccgatgctgagaagcaagtg
gaacgtcaccgaagactgttcaagaaaattacccaacgtggtccagatgcgttcaataag
ctgtgtgacatatgtgccgccttgcattatgacacagctttaggaatactgaggccggac
agatacgtttcgataaagagcaataaaatggcgatatcatcgggatcaatgaaccattgt
caacagaatgctaattatattaacaataacaccagcagcaataataacgatgatagtaga
cgcagcagtataagcatcgatgatgatgaagacaatggggatggagcttatcagcagact
gaccgcagacgtagcagcagtaaaacattggactctgtgagtgtactgcaagagtatact
ggtgaaatttgtcccaaagataagtttgaagtgaaaagagccgcaaggatacttaagcat
cctagtttggacacatatccaatgcagtctaaagaaaatcgtggagttttcttcatggtt
aatatgatcaactttcccgtggaaacgcatcgtcgagatggtgccgatgaggatacacat
tcactgctgtatcttttcaaacagctgggttttaaactattctcctatacgaatctatca
cacgaagttttcttcgacatattgggtaaacttctgaaatcagattacacgaagaacacg
gagtgctttgtaatggcacttatgacccatggtgatatggatgacagtgtgcagcgtatt
acattcagtgatggctctgtggtcaaagtgaaagatattgaggattatttcaatcatcat
gtctgtgagaatctggtgaataaacctaaaatattcctattcccattttgtcgcggtgat
atgttggaacatggtgtcatcaataaagtacagactgatagtatacaatacaatacacat
agaattaaaaatatacccatcttatccgatttgattgtctgctatgccacatcggaaggt
tttaaggctcatcgcgacccggccgatggatcgtggtacatccagagtttcgttaagaat
atggcgaaaaatgctcatgatacatcctttgaagatatccttaagaatattcaagccgac
acattgaaattacgaacaattgacggaagtttgcagacagccaattatgtgaatagagga
ttcaataaggcattgtattttaatcctcgcatttggctggaataa

DBGET integrated database retrieval system