KEGG   Musca domestica (house fly): 101897249
Entry
101897249         CDS       T03448                                 

Definition
(RefSeq) beclin-1-like protein
  KO
K08334  beclin
Organism
mde  Musca domestica (house fly)
Pathway
mde04136  Autophagy - other
mde04137  Mitophagy - animal
mde04140  Autophagy - animal
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101897249
   04136 Autophagy - other
    101897249
   04137 Mitophagy - animal
    101897249
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    101897249
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mde04131]
    101897249
   03029 Mitochondrial biogenesis [BR:mde03029]
    101897249
Membrane trafficking [BR:mde04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    101897249
Mitochondrial biogenesis [BR:mde03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    101897249
SSDB
Motif
Pfam: APG6 APG6_N DUF2147 GAS
Other DBs
NCBI-GeneID: 101897249
NCBI-ProteinID: XP_005189450
UniProt: A0A1I8NIJ5
LinkDB
Position
Unknown
AA seq 425 aa
MSQTGDVEKVPVSFACQRCLQPILLDENLENISVHAMAELSLPIYASNVNTLDNQDNSFD
HFVPPYRLTDSVNGTGFMLVSDGRDNKKWSAAFKLKAELFDCLSSNSEIDHPLCEECADS
MLEIMDRELKIAEDEWSDYKNYLKQLEQQQDCPNIGELEKELAELKENEQALLNQLNDLK
VEEQSLNDAIEKEEVEKQKLQEQEASYWREYTKHRRELMLTEDDKRSLECQIAYAEQQLE
KLKDANIFNITFHIWHAGHFGTINNFRLGRLPSASVDWSEINAAWGQTVLLLCALARKIG
LTFERYRIVPFGNHSYVEVLGENRELPLYGTGGFKFFWDTKFDAAMVAFLDCLTQFQQEV
EKRDPEFLLPYKMEKGKIIDPSTGNSYSIKIQFNSEEQWTKALKFMLTNLKWGLAWVSSQ
FASNQ
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgagtcaaacgggagatgtggaaaaggttccggtgtccttcgcctgccagcgatgtctg
caacccatattgttagatgaaaatctggaaaacattagtgttcatgcaatggcagagttg
tctctacccatctatgcaagcaatgtcaacacactggataatcaggacaacagctttgat
cattttgtgccaccctatcgtttaacggattccgtaaatggcacaggcttcatgttggtg
tccgatggtcgtgacaacaagaaatggagtgctgcatttaaattgaaagctgaactgttc
gattgtttgtcctccaattcggaaattgatcatccactgtgtgaagaatgtgctgattcc
atgctggagatcatggatagggagctgaaaatagccgaagatgaatggagtgattataag
aattacttaaaacaattggaacaacagcaagattgtccaaatataggagaactggaaaaa
gaattggctgagctaaaggaaaatgaacaggctctgttgaatcagttgaatgatttgaaa
gttgaggagcaaagccttaacgatgccattgaaaaagaggaggtggagaaacaaaaactg
caggaacaggaggcaagttattggcgtgaatataccaagcatcgaagagaactgatgcta
acggaggatgacaaacgtagtctggagtgtcaaattgcctacgccgaacagcagttggag
aaacttaaagatgccaacattttcaacataacattccatatatggcatgctggacatttt
ggtacaattaacaactttcgtttggggcgtctgccatcggcctcggttgattggtcggaa
attaatgctgcatggggacaaacggtgctgttgctgtgcgctttggcgcgtaaaattgga
cttacatttgagcgatatcgcattgtaccctttggcaatcattcatatgttgaggtattg
ggggaaaatcgtgaattacctttatatggcactggcggttttaaattcttctgggatacc
aaatttgatgcagcaatggttgcatttttggattgcctaacacaattccagcaggaggtg
gagaaaagagatccagaatttctattaccctataaaatggaaaagggtaaaataattgat
ccctcgacggggaactcgtattccatcaagatacaattcaattccgaggaacagtggaca
aaggctctaaagtttatgcttacaaatctcaaatggggtctagcctgggtgtcgtctcaa
tttgccagtaatcaatag

DBGET integrated database retrieval system