KEGG   Musca domestica (house fly): 101897519Help
Entry
101897519         CDS       T03448                                 

Definition
(RefSeq) microsomal glutathione S-transferase 1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mde  Musca domestica (house fly)
Pathway
mde00480  Glutathione metabolism
mde00980  Metabolism of xenobiotics by cytochrome P450
mde00982  Drug metabolism - cytochrome P450
mde00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:mde00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101897519
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101897519
   00982 Drug metabolism - cytochrome P450
    101897519
   00983 Drug metabolism - other enzymes
    101897519
Enzymes [BR:mde01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101897519
Transporters [BR:mde02000]
 Other Transporters
  Pores ion channels [TC:1]
   101897519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 101897519
NCBI-ProteinID: XP_005185994
UniProt: A0A1I8NHB2
LinkDB All DBs
Position
Unknown
AA seq 150 aa AA seqDB search
MAVLDLLSFDNAVFKAYVFWSGVLVLKMLMMSLLTAMQRFKTKTFANPEDCMSKKDKVTY
DNPYVERVRRAHLNDLENILPFFAAGFFYILTNPSAFIAINLFRAVAAARILHTIVYAVV
VIPQPARALSFFVAFLATGYMALQVVLYAL
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atggccgtattggatttattatctttcgataatgccgtcttcaaagcctacgtcttctgg
agtggtgttttggtgctgaaaatgttgatgatgtccctgctcaccgccatgcaacgtttc
aagaccaagacctttgccaatcccgaagattgcatgtcgaagaaggataaggtgacctat
gacaatccctacgttgaacgtgttcgcagagcccacttgaacgacttggaaaacattttg
cctttcttcgctgccggtttcttctacatcttgaccaacccctcggccttcattgccatt
aacttgttccgtgccgtcgctgctgcccgtattctccacacaattgtctatgccgttgtt
gttattccccaacccgctcgtgccttgtccttcttcgtcgccttcttggccaccggctat
atggctttgcaagtcgttttgtatgccttgtaa

DBGET integrated database retrieval system