KEGG   Musca domestica (house fly): 101898176Help
Entry
101898176         CDS       T03448                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mde  Musca domestica (house fly)
Pathway
mde00020  Citrate cycle (TCA cycle)
mde00190  Oxidative phosphorylation
mde01100  Metabolic pathways
mde01200  Carbon metabolism
Module
mde_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mde_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mde_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101898176
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101898176
Enzymes [BR:mde01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101898176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 GIDA DAO HI0933_like FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 101898176
NCBI-ProteinID: XP_005176415
UniProt: T1PAV8
LinkDB All DBs
Position
Unknown
AA seq 659 aa AA seqDB search
MASLMRVPSILAKNAAAMLRASSVVPQRELHIGNGRRDASTKSDAISKEYPIVDHAYDAI
VVGAGGAGLRAAFGLVAEGFKTAVITKLFPTRSHTIAAQGGINAALGNMEEDDWKWHMYD
TVKGSDWLGDQDAIHYMTREAPKAVIELENYGMPFSRTPDGKIYQRAFGGQSLKFGKGGQ
AHRCCAVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLLMENGECRGVIALNLEDGTLH
RFRARNTVMATGGYGRAYFSCTSAHTCTGDGTAMVARQGLPSQDLEFVQFHPTGIYGAGC
LITEGCRGEGGYLVNAKGERFMERYAPVAKDLASRDVVSRSMTIEIMEGRGVGPEKDHVY
LQLHHLPPEQLAQRLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGIPTNYKGQVLTID
ANGNDKVVPGLYAAGESACSSVHGANRLGANSLLDLVVFGRACAKTIAEENKPGATPPSL
KDNAGEMSVANLDKLRHANGSITTADLRLKMQKTMQHHAAVFRDGPVLKEGVEKMSDIYQ
QFKDIKVVDKSMVWNSDLVETLELQNLLANAKMTIVGAENRKESRGAHAREDFKTRIDEY
DYSKPVDGQQKKPLDEHWRKHTLLWVTDEKGTVEIKYRPVIDHTLDDTVTTVPPAIRSY
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcgagtttaatgcgagtgccatcgattttggctaaaaatgccgctgctatgcttcgt
gcctcatccgttgtgccacaacgtgaattgcacattggcaatggccgtcgcgatgcttct
accaaatcagatgctatttcaaaggaatatccaattgtggatcatgcctatgatgctatt
gtagtaggtgccggtggtgctggtttgcgtgctgctttcggcttggtagctgagggcttc
aaaacagctgtcattacaaaattgttccccacacgttcacacaccattgccgctcaaggt
ggtatcaatgccgctctgggtaacatggaagaagatgactggaaatggcacatgtatgac
acagttaagggctccgattggttgggtgatcaagatgccatccattacatgacccgcgaa
gcccccaaggctgtcattgaattggaaaattatggtatgcccttctcccgtacacccgat
ggtaaaatctaccaacgtgcctttggtggtcaaagtttgaaatttggcaagggtggtcaa
gcccacagatgttgtgctgttgctgacagaactggtcactctttgttgcacaccctttac
ggtcaatcattgagctacgattgtaactatttcgttgaatactttgctttggatttgttg
atggaaaacggtgaatgccgcggtgttattgccttgaacttggaagatggtacattgcat
cgtttccgtgcccgcaacactgttatggccactggtggttatggtcgtgcttacttctcc
tgcacctctgctcacacttgcactggtgacggtactgccatggttgctcgccaaggcctt
ccctcacaagatttggaattcgtacaattccatcctactggtatttacggtgctggttgc
cttattaccgaaggttgccgtggtgaaggcggttacctggttaatgccaagggtgaacgt
ttcatggaacgttatgctcctgtagctaaagatttggcctctcgtgatgttgtctcccgt
tccatgaccattgaaattatggaaggccgtggtgttggccccgaaaaggatcatgtctac
ttgcaattgcatcatttgcccccagagcagttggcccaacgtttgcctggtatctccgaa
actgctatgatcttcgctggtgtcgatgtcacacgtgaacccattcctgtattgcctact
gtacattacaacatgggtggtattcctacaaactacaagggtcaagtattgaccatcgat
gctaacggcaatgacaaggttgttcctggtttgtatgctgctggtgaatctgcctgttcc
tctgtgcatggtgctaaccgtttgggtgctaactcattgctggatttggttgtctttgga
cgtgcctgcgccaagaccattgccgaagaaaacaaacctggtgccacaccaccatccctt
aaagataatgctggtgaaatgtctgttgccaacttggataaattgcgtcatgccaatggt
agcatcaccacagccgatttgcgcttgaaaatgcaaaagactatgcaacatcatgctgct
gtcttccgtgatggccctgtacttaaggaaggtgttgagaagatgtctgacatctatcaa
caattcaaggatattaaggttgtagacaaatccatggtttggaactccgatttggttgaa
actttggaattgcagaaccttttggccaatgcaaaaatgaccattgtgggcgctgaaaac
cgcaaggaatcccgtggtgctcatgcccgtgaagatttcaaaactcgcattgatgaatac
gactacagcaaacctgttgatggtcaacaaaagaaacccttggacgaacattggcgcaaa
cacacactcttgtgggtcactgatgagaagggtaccgtcgaaatcaaatacagacctgtt
atcgatcataccttggatgataccgtgacaactgtacctcctgctattcgctcgtattaa

DBGET integrated database retrieval system