KEGG   Musca domestica (house fly): 101898798Help
Entry
101898798         CDS       T03448                                 

Definition
(RefSeq) maltase 2 isoform X2
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mde  Musca domestica (house fly)
Pathway
mde00052  Galactose metabolism
mde00500  Starch and sucrose metabolism
mde01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mde00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101898798
   00500 Starch and sucrose metabolism
    101898798
Enzymes [BR:mde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     101898798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF4363
Motif
Other DBs
NCBI-GeneID: 101898798
NCBI-ProteinID: XP_011294676
LinkDB All DBs
Position
Unknown
AA seq 600 aa AA seqDB search
MNLQYWRNSVINRKMTNQMRALQTMAALASAESSEEASNAVGDIDNEWWKTAVFYQIYPR
SFMDSNDDGIGDLRGVLSKLSYLAETGITATWLSPIFQSPMIDFGYDISDFKAIHEEYGT
MEDFEELISEANRLNIKIILDFVPNHSSDQCEWFIKSAAREEGYEDFYVWADGHINEDGE
MEPPNNWQSVFYGSAWTWHPERGQYYYHQFTAEQPDLNYRNSKVVEAMDDVITFWLDKGV
SGFRVDAVNHLFEDPELRDEPLSGKTQDKSSHLYTEHIYTKDLPEVYDMLYHWRNLLDEY
TEKHGGPARIMMTEAYADLKFLMDYYENADGSKGPHFPFNFFLLTDISQTSDARDYVFNI
QKWLTYMPRNHVANWVMSNHDNPRIASRLGVDSVDAMNMLLMTLPGVAVTYNGDEIGMQD
FRDISWEDTVDPPARNVGPDKYKEVSRDPVRTPFQWSGEKNAGFSNADKTWLPVHPNYEE
LNLEIQKSLEKSHYSVYKDLIELRKLPVMEQGRTALEVISRNVFTVTRSLKGHSSILTII
NTSDEEQMVNLLEVLDEDIKQLTVLVSGVNSIYDKGTEIPQEDFEHFILTPQEALVCMIA
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacaatattggcgcaattctgtaataaacaggaaaatgaccaaccaaatgaga
gctcttcaaacaatggcggcgttagcatcagcagagagcagtgaagaagcgagcaatgct
gttggggacatcgacaatgaatggtggaaaacggcagtgttctatcaaatctatccaaga
tcgtttatggacagcaacgacgatggcatcggtgacctgagaggtgttttgtcgaaatta
agctatctagcggaaacaggtataactgccacctggctgagtcccattttccaatcacca
atgattgattttggctatgacatctccgactttaaagctatacacgaggagtatggcaca
atggaagattttgaggaattgatttctgaagcgaatcgtttgaatatcaaaatcattttg
gattttgtacccaaccattcgtcggaccagtgcgaatggttcattaaatctgcagctagg
gaggaaggttatgaggatttttacgtttgggcagatggccatataaacgaggatggcgaa
atggaaccaccaaataattggcaatcggtattttatggttcagcatggacttggcatcct
gaacggggacaatattattatcaccagtttacggccgaacagccggatttaaattatcgc
aacagtaaagtggtcgaagctatggacgatgttatcaccttttggttggacaagggtgtc
agtggatttcgcgttgatgcggtcaatcacctatttgaggatccggaattaagagatgag
ccgctgagcggcaaaacacaagataaatcctcacatctttatactgaacacatctatact
aaagatttgcccgaggtgtatgacatgttgtatcactggcgtaacctgctcgacgagtac
actgaaaagcatggaggtcctgcccgcataatgatgacagaagcctatgccgatcttaaa
tttttaatggattattacgagaatgcggatggttccaaaggtcctcatttcccgtttaat
ttcttcttgcttaccgacatttctcaaacatcggatgccagagattatgttttcaatatc
caaaagtggttgacatatatgccccggaaccatgttgccaattgggtgatgagtaatcat
gataatccacgcatagcttcaaggttgggagttgacagtgttgatgccatgaatatgctg
ttaatgactctcccgggcgtggctgtgacatacaatggcgatgaaatcggaatgcaagat
tttcgtgatataagctgggaagatacggttgatccaccggcacgcaacgttggtccggat
aaatataaggaagtctccagggacccagtacgtactcctttccaatggagcggcgagaaa
aatgcaggtttctccaatgccgataagacatggctacctgtccatcccaactatgaggaa
cttaatttggaaattcaaaaatcgttggagaaaagtcattatagtgtttacaaggatctc
atcgaattgagaaaactgccagtaatggaacaaggacgaacggcattagaggtcatttct
cgaaacgtatttactgtaacaagatccctcaagggccactcatcgattttaacaattatc
aacaccagtgacgaagaacaaatggtgaatttactagaggttctggatgaagacattaaa
cagttgactgttcttgtatccggcgttaattccatttatgacaaagggactgaaataccc
caagaagactttgaacacttcatactgacgccacaggaagctcttgtttgcatgattgca
taa

DBGET integrated database retrieval system