KEGG   Musca domestica (house fly): 101899191Help
Entry
101899191         CDS       T03448                                 

Definition
(RefSeq) RAC serine/threonine-protein kinase
  KO
K04456  RAC serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mde  Musca domestica (house fly)
Pathway
mde04068  FoxO signaling pathway
mde04140  Autophagy - animal
mde04150  mTOR signaling pathway
mde04213  Longevity regulating pathway - multiple species
mde04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:mde00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    101899191
   04150 mTOR signaling pathway
    101899191
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101899191
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    101899191
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101899191
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mde01001]
    101899191
Enzymes [BR:mde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101899191
Protein kinases [BR:mde01001]
 Serine/threonine kinases: AGC group
  AKT/PKB family
   101899191
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PH Pkinase_C Kinase-like PH_11 FTA2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101899191
NCBI-ProteinID: XP_005186507
UniProt: T1P884
LinkDB All DBs
Position
Unknown
AA seq 522 aa AA seqDB search
MSEIGAIPTANEAGGTHSNATIVKEGWLQKRGEHIKTWRSRYFILRSDGTLHGWRNKPNE
NAPPERPLNDFTIKGCQIMTVDRPRPYTFIIRGLQWTSVVERTFSVDTERERQEWTDAIR
TVASSLSELGETAMSTTNSTDMTDVDMASIAEDELCEKFSVQGTSTRSSGGVKKVTLENF
EFLKVLGKGTYGKVILCREKATAKLYAIKILKKEVIIQKDEVAHTITESRVLQTTNHPFL
ISLKYSFQTNDRLCFVMQYVNGGELFFHLSRKRVFSEERTRFYGAEIISALGYLHSQSII
YRDLKLENLLLDKDGHIKIADFGLCKEDITYGRTTRTFCGTPEYLAPEVLEDNDYGRAVD
WWGTGVVMYEMMCGRLPFYNRDHDVLFTLILVEEVKFPRTISDEAKSLLAGLLAKDPKKR
LGGGPGDVKEIEVHPFFDSINWTDLVQKKIEPPFKPQVTSDTDTRYFDTEFTGESVELTP
PDPTGPLGSIAEEPHFPQFSYQDMASTLGTSSHISNSLASMQ
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaatcggtgcgattccaaccgccaatgaagccggaggaacacactccaacgcc
acaatagtcaaagagggctggttacagaaacgcggggaacacatcaaaacttggcgctct
cgttatttcatactgcgatcggatggcactctccatggttggcggaacaagccgaatgag
aatgctccgcccgaaaggcccctaaatgattttacaattaagggctgtcaaatcatgaca
gtagatcgccctaggccctacacgttcatcatacgcgggttgcagtggacttctgtcgta
gaacgcactttttccgttgatactgaaagggaaaggcaggaatggaccgacgccataaga
actgtggccagtagcttgagtgaattgggcgaaaccgccatgagcactacaaacagcaca
gatatgaccgatgtcgatatggcttccatagcggaggatgagttatgtgaaaagttctct
gttcagggtacgtctacacgcagcagtggcggagttaagaaagtgactctggagaacttt
gaatttttaaaggtgttgggaaaaggcacatatggcaaggtgatattgtgtcgtgagaag
gcaactgccaaactgtatgccatcaagattttgaagaaggaggtgatcatccaaaaagat
gaagtcgctcacacaattacagaaagccgagttttgcaaacaacaaatcatccattctta
atatccctcaaatattccttccaaacgaatgatcgcctttgctttgtaatgcaatacgta
aatggcggtgaactcttctttcatttgagtcgcaaacgtgttttcagtgaggaacgtacc
cgtttctatggggctgaaatcatatcagccctgggatatctgcattcacagagcatcatt
tatcgcgacttgaagctggaaaatctgttgttggacaaagatggccacattaaaattgca
gactttggcctttgcaaggaggacataacctacggtcgcactacaaggactttctgcggc
acgccggaatatttggcgccagaagtattagaagacaacgattacggccgtgcagtggat
tggtggggtactggtgttgttatgtacgagatgatgtgtggacgtcttcctttctataat
cgtgatcacgatgtcctcttcacactaattcttgttgaagaggtcaagtttccacgtaca
atatcggatgaagccaaaagtctgctggccggtctattggcaaaagatcccaaaaaacgt
ttgggtggcggtccaggtgatgtcaaagaaatcgaagtacatccgttctttgatagcatt
aactggactgatttggtgcaaaagaagatcgagcctcctttcaaaccacaagtaacatcg
gacacagacacacgctatttcgatacagagttcactggcgagagtgtcgaattgacacca
ccagatcccacaggccccttgggttcgatagccgaagaacctcacttcccacagttcagt
tatcaggatatggcctccacattaggtacttcatcacacattagcaattcgttggcatcg
atgcaatag

DBGET integrated database retrieval system