KEGG   Musca domestica (house fly): 101899570
Entry
101899570         CDS       T03448                                 

Definition
(RefSeq) uncharacterized protein LOC101899570
  KO
K02187  caspase 3 [EC:3.4.22.56]
Organism
mde  Musca domestica (house fly)
Pathway
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    101899570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mde01002]
    101899570
Enzymes [BR:mde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.56  caspase-3
     101899570
Peptidases and inhibitors [BR:mde01002]
 Cysteine peptidases
  Family C14: caspase family
   101899570
SSDB
Motif
Pfam: Peptidase_C14 Glyco_transf_54
Other DBs
NCBI-GeneID: 101899570
NCBI-ProteinID: XP_005177680
LinkDB
Position
Unknown
AA seq 150 aa
MAPKDMCVVIVVATDYDRDGLDQDRAAISEAFNASFEVKLVELIDENIKTVDDIFKSFAK
DKEWLDEFEKCKFVAVFCMSHGQADGLIKLTTKNEVEDAGKTMKKINEVADARRHLLCPL
FKIKQLDSKLKWLVVQACRGELNGYKPMQK
NT seq 450 nt   +upstreamnt  +downstreamnt
atggctccgaaggatatgtgtgttgtcattgtcgttgcaactgactacgatagagatggc
ttagaccaagatagagccgcaatttctgaggccttcaacgcatctttcgaagtaaaacta
gtcgagctgatcgatgaaaatattaaaaccgtggatgatatattcaaatcatttgcgaag
gacaaggaatggttagacgaatttgaaaaatgtaagtttgttgcagttttttgcatgtct
cacggccaggccgatggtctaattaagctaacaacaaaaaacgaagtggaagacgcagga
aaaactatgaagaagatcaacgaagtagcagacgcccggagacacttactttgtcctcta
ttcaaaatcaagcaattagattcaaaactaaaatggttagttgtgcaggcctgtcgagga
gaactaaatggttacaaaccaatgcaaaaa

DBGET integrated database retrieval system