KEGG   Musca domestica (house fly): 101900122
Entry
101900122         CDS       T03448                                 

Definition
(RefSeq) caspase-8
  KO
K04398  caspase 8 [EC:3.4.22.61]
Organism
mde  Musca domestica (house fly)
Pathway
mde04214  Apoptosis - fly
mde04215  Apoptosis - multiple species
mde04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    101900122
   04215 Apoptosis - multiple species
    101900122
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    101900122
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mde01002]
    101900122
Enzymes [BR:mde01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.61  caspase-8
     101900122
Peptidases and inhibitors [BR:mde01002]
 Cysteine peptidases
  Family C14: caspase family
   101900122
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 101900122
NCBI-ProteinID: XP_005174928
UniProt: A0A1I8M1X4
LinkDB
Position
Unknown
AA seq 556 aa
MAYRRKTLMDRINDIDIEDLQYVERDLCFYELVSLGFLLYGREKTTAEYILQKLIVLQQN
PPQGKGLESTNSDILRKYATINSHTWQLNIIEALAIIRARKVLRKLGFVWQELRDIYLPH
LPEISVHIHPMLKALYKICERLSTTQAGRMVMKINERHLQREAHNLRFYDYEYLEVFLLF
WITRDVISIGNQNLQGVDVLNLKAYFKENDLDSMKAILDDTINHNFGRRDNVVASDSNGG
RPGPIYGHIGGAVTATPGAAGMANGRPDGDANQDSGAVMDSLDMHSGEQQQQPGVQEANN
SPSTEEIHEEFDHTERYLIRTKHAGYVLIINQSDFYLDTNPEFKELLPERPFKKQRAGTD
VDRDKLKELFSSFGYTPVVCNNLTHEEMQNTIRDTVQRSLLRDSLIVCILTHGMEGVVYG
CNSVPVSINQIKTIMADDSLRGKPKLLIIQACQKNIAPVDTSISNSKRNLEVDTYADMLT
AMSSIPGTEALRHTISGSWFIDSLYKLTNKWCSRKHMLDILTSVTADVAKRRDKQDYMLP
IMSSTLRKDFFLPPRI
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggcatatcgtcgtaaaaccttgatggatcgcatcaatgacatagacatcgaggattta
caatatgtcgaaagggatttgtgtttctatgaattggtatctttgggatttctattgtat
ggtcgtgagaaaaccaccgctgaatatattttacaaaaacttattgtactgcaacaaaat
ccaccgcaaggcaaaggcttggagtcgacgaacagtgatatactacgcaaatatgccacg
ataaacagccacacttggcagctaaatataatcgaagctttagctattattcgtgccagg
aaggtactacgaaaattgggattcgtttggcaggaactacgtgatatttatttaccccat
ctgcccgaaatcagtgttcacatacatcccatgctaaaggcactctacaagatttgtgaa
cgtctgtccactacccaggccgggcgtatggtaatgaaaatcaatgaaaggcatttacaa
cgcgaggcacacaatctacgtttctatgactatgaatatttggaagtgttcctcttgttt
tggataacaagagatgtcatttcaattggcaatcaaaatctccagggtgtagatgtattg
aatttgaaggcatatttcaaggaaaatgatttggattccatgaaagccatattagatgat
acaatcaatcataattttggacgacgtgacaatgtggtggcaagtgattcaaatggtggt
agaccaggaccaatatatgggcacattggcggtgctgttactgcaacaccaggtgcagca
ggcatggcaaatggtcgtccagatggggatgcaaatcaagattctggagctgtaatggat
tctctggatatgcattcgggcgaacagcaacaacagccaggtgttcaagaagcaaacaac
tcgccatccactgaggaaatacatgaagaattcgatcataccgaacgttatttgatacgt
acaaagcatgctggttatgttttaattataaatcaaagtgatttctatctggacaccaat
ccggaatttaaggaactcttgcccgaaagacccttcaaaaaacaacgtgctggcactgat
gttgaccgggataaactcaaagaacttttctcttcgttcggctatacgccggtggtgtgc
aataatctaacccacgaagaaatgcaaaacacaatacgggacaccgtccaaagatctctg
ctaagagactcacttattgtttgtatattaactcatggcatggaaggtgttgtctatggc
tgtaacagtgtgccagttagcataaatcaaataaaaaccattatggccgatgattcgctg
aggggcaaacctaaattgttgataatacaagcatgtcaaaagaacattgccccagtggat
acgagcatttcgaattcgaaacgaaacttggaagttgatacctatgctgatatgctaaca
gcaatgtcctccataccgggtactgaggccctacgtcacaccatatcgggtagttggttt
atcgattcattgtataaactcacaaacaaatggtgttcacgaaaacacatgctggatata
ttgacaagcgttacagccgatgtggccaaaagacgtgacaaacaagactatatgttaccc
attatgagctccactttgagaaaagatttctttttacctccacgcatttga

DBGET integrated database retrieval system