KEGG   Musca domestica (house fly): 101900208
Entry
101900208         CDS       T03448                                 

Definition
(RefSeq) baculoviral IAP repeat-containing protein 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
mde  Musca domestica (house fly)
Pathway
mde04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mde00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    101900208
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mde01002]
    101900208
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mde03036]
    101900208
Peptidases and inhibitors [BR:mde01002]
 Peptidase inhibitors
  Family I32: IAP family
   101900208
Chromosome and associated proteins [BR:mde03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     101900208
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101900208
SSDB
Motif
Pfam: BIR zf-C3HC
Other DBs
NCBI-GeneID: 101900208
NCBI-ProteinID: XP_005184865
UniProt: A0A1I8MA93
LinkDB
Position
Unknown
AA seq 144 aa
MSEMRSEKFKKFNKVYLLEKQRIDSFKNWPYDEAADCSISKMAQAGFYWSGNKSDDDTVT
CFVCGKTLHGWDPTDDPWKEHAKHAPQCQFVKYGHKEADLTVEEFLNIFSAVGMNKMMKD
FNGIKSKFLAQASSEMEKCLMEKK
NT seq 435 nt   +upstreamnt  +downstreamnt
atgagcgaaatgcgtagtgaaaagttcaaaaaatttaataaagtctatctgctggaaaaa
caacgaatcgatagttttaagaattggccttacgacgaggcagccgattgtagcatcagt
aaaatggctcaagctggtttctattggtcggggaataaaagtgacgacgacactgtgacc
tgttttgtatgtggcaaaaccctgcacggttgggatcccaccgatgatccttggaaagaa
catgccaagcatgcgccacaatgtcaatttgttaaatatggtcacaaagaagctgatctg
acggtggaagagttcctgaatatcttctctgccgttgggatgaacaaaatgatgaaggat
tttaatggcattaagtcaaaatttctggcacaagcctcatccgaaatggaaaaatgttta
atggaaaagaaatag

DBGET integrated database retrieval system