KEGG   Musca domestica (house fly): 101901606Help
Entry
101901606         CDS       T03448                                 

Definition
(RefSeq) histone deacetylase Rpd3
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
mde  Musca domestica (house fly)
Pathway
mde04213  Longevity regulating pathway - multiple species
mde04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mde00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    101901606
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    101901606
Enzymes [BR:mde01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     101901606
Chromosome and associated proteins [BR:mde03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     101901606
   HDAC complexes
    Sin3A-HDAC complex
     101901606
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    101901606
  Chromatin remodeling factors
   NuRD complex
    101901606
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 101901606
NCBI-ProteinID: XP_005191575
UniProt: A0A1I8M0Y6
LinkDB All DBs
Position
Unknown
AA seq 485 aa AA seqDB search
MQSAHSKKRVCYYYDSDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATA
DEMTKFHSDEYVRFLRSIRPDNMTEYNKQMQRFNVGEDCPVFDGLYEFCQLSAGGSVAAA
VKLNKQASEICINWGGGLHHAKKSEASGFCYVNDIVLGILELLKYHQRVLYIDIDVHHGD
GVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNIPLRDGMDDEAYESIF
EPIISKVMETFQPAAVVLQCGADSLTGDRLGCFNLTVKGHGRCVEFVKKYNLPFLMVGGG
GYTIRNVSRCWTYETSVALGVEIANELPYNDYFEYFGPDFKLHISPSNMTNQNTTEYLEK
IRNRLFENLRMLPHAPGVQIQAIPEDAINDESEDEDKVDKDERLTQADKDKRIVPDNEFS
DSEDEGEGGRRDNRSYKGQRKRPRLDKEGGKATENSEAKDDKEKMDTTETEEPAKSEDGK
KENNI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctgcccatagtaaaaaaagagtgtgctattattatgacagtgatattggcaac
tattactatggccagggacatcccatgaaacctcatcgtatacgtatgacccataatctg
ttgctcaactatgggctctatagaaaaatggaaatttatcgtccccacaaagccactgcc
gatgaaatgaccaaattccattcagatgaatatgttcgcttcctacgatcgataagaccc
gacaatatgactgaatacaacaaacaaatgcaacggtttaacgttggcgaggattgtcct
gtctttgatggtctctatgagttctgtcagctttctgcgggtggttctgttgctgctgcc
gttaaactgaataaacaagcctccgaaatttgcattaattggggtggtggtctgcatcat
gccaaaaaatctgaagcatctggattttgttatgttaacgatattgttttgggcattttg
gaattgttgaaatatcaccagcgtgttctttacatagatatcgatgtccatcatggtgat
ggtgtggaagaagctttctatacaacagatcgtgtgatgacggttagttttcacaaatat
ggtgaatatttccctggcactggggatttgcgtgatattggtgctggtaagggtaaatat
tatgctgttaacataccgctgcgtgatggcatggatgatgaggcatacgaatcgatattt
gaaccaatcatctccaaagttatggaaactttccaacccgccgccgtggtcttgcagtgt
ggtgctgattcgctgactggcgatcgtttgggttgctttaatttaacggtcaagggacac
ggtcgttgtgtggaatttgtaaagaaatataatctgccgttcttaatggttggtggtggt
ggctataccattcgtaatgtatcacgttgttggacatatgaaacatcggtggccctgggt
gtggaaatagcaaatgaattgccatacaatgattactttgaatatttcggtcccgatttt
aaacttcacatcagtcccagcaatatgacaaatcaaaatacaacagaatatttggaaaag
atcagaaatcggctctttgaaaacttgcgtatgttaccacatgcacccggcgtgcaaatt
caggcgatacccgaagatgcaatcaacgatgaatcagaagatgaagataaagttgacaaa
gacgaaagattaactcaggccgataaagataaacgtattgtgccggacaatgaattctcc
gattcagaagatgagggtgaaggcggccgtagagataatcgttcctacaagggtcaaaga
aaacgaccacggctcgataaagaaggtggcaaggcaacagagaattccgaagccaaagat
gacaaagagaaaatggacacaacagaaaccgaagaacctgctaaaagtgaggatggcaaa
aaagagaacaacatatga

DBGET integrated database retrieval system