Musca domestica (house fly): 105262243 Help Entry 105262243         CDS       T03448                                  Name (RefSeq) probable insulin-like peptide 5   KO K04526   insulin Organism mde  Musca domestica (house fly) Pathway mde04068   FoxO signaling pathway mde04140   Autophagy - animal mde04150   mTOR signaling pathway mde04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:mde00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     105262243    04150 mTOR signaling pathway     105262243  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105262243  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     105262243  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mde04052]     105262243 Cytokines and neuropeptides [BR:mde04052]  Neuropeptides   Neuropeptides (Unclassified)    105262243 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  105262243 NCBI-ProteinID:  XP_011295054 UniProt:  A0A1I8NJJ7 LinkDB All DBs Position Unknown AA seq 116 aa AA seqDB search MKLLYFIIGCVALYKCVAQLQTRVCGPSLSQLLQTVCENGFNPKFDKKSNVPPYLFISKL SKRSGKEPLQPLFADMLFNKRPSAVASARQERIYSGVYDECCRKTCSFNEIVDYCL NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atgaaacttctatattttataataggctgtgtcgcgttgtataagtgtgtggctcaattg caaacccgtgtctgtggaccaagtttatcgcaacttttgcaaactgtctgcgaaaatggc ttcaatccgaaattcgacaaaaaatccaatgtgcccccttatctcttcatttcaaaactg tctaagagaagtggcaaagaaccactacaaccactttttgccgatatgctattcaataaa cgacccagtgcagttgccagtgctcgtcaagaacgtatatattccggtgtttatgatgaa tgttgtcgcaaaacgtgcagctttaatgaaattgttgactattgcttatag

DBGET integrated database retrieval system