KEGG   Methylomonas sp. DH-1: AYM39_02950Help
Entry
AYM39_02950       CDS       T04396                                 

Definition
(GenBank) ribonuclease BN
  KO
K07058  membrane protein
Organism
mdh  Methylomonas sp. DH-1
Brite
KEGG Orthology (KO) [BR:mdh00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    AYM39_02950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB MarR_2
Motif
Other DBs
NCBI-ProteinID: ANE57570
UniProt: A0A172UE01
LinkDB All DBs
Position
646302..647615
Genome map
AA seq 437 aa AA seqDB search
MAMNLLLFCKEDIWRLDERSLAWWPALCVRCLKIALLAVQGFRRDLCQLRASALTLYSIL
SIVPVIAMLFGIAKGFGFEKLLQRQLLERAPQQDELMLRLIGFAQNLLAKTQGEVVAGIG
IAVLFWTVVSLIANIEESFNFIWKIEQGRSWSRKCSDYLSLMLLGPVLLMAASGLTVFLQ
TQVGWLAGAIHLPAFGVWLVLKALGLSPLLLMIVLFTVVFVFMPNHAIDYRAGLVAGVVT
GLLYHGLQWAYLSLQIGVSSYNAIYGSFAALPLFVVWLQSCWIIVLFGCEMAFYIQNYPI
HRHGDRFGNLSFSLKKILALQITHALVKRFLKQEAPPSAEELARDLMIPLALVQALLNKL
IASRIVVEFCHPEQTVSVFQPAVDINILSIGYVVDALECCGQNQLPDIQPQQDFAEAVDH
FRQAMADSAGNRLLKNI
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgaatctgttgctgttctgcaaagaggatatttggcggctggatgagcggagt
ctggcctggtggccggcgctatgcgtccgttgtctgaagatcgcgttgttggcggtgcaa
ggctttcgccgcgatttatgccaactgcgggcctcggcactgaccttgtacagcatcctg
tccatcgtgccggtgattgcgatgttgttcggtatcgccaagggcttcggtttcgaaaag
ctgctgcaacggcagctattggagcgagcgccgcagcaggacgaactgatgctgcgcttg
atcggcttcgctcaaaacctactggccaagacccagggcgaagtggtggccggcatcggt
atcgccgtgttgttctggaccgtggtcagcctgatcgccaacatcgaagaatcgttcaat
ttcatctggaaaatcgagcagggccgcagttggagccgcaaatgcagcgactatttgtcg
ctgatgttgttggggccggtattgttgatggcggccagcgggcttaccgtgttcctgcaa
actcaggtcggctggctggccggcgcgatccatttgccggctttcggcgtctggttggtg
ttaaaggccttgggcctgtcgccgctgttgctgatgatcgtgctatttacggtggtcttc
gtatttatgcctaaccatgccatagactaccgtgccgggctggttgccggcgttgtgacc
gggctgctttaccacggcttgcagtgggcctatttgagtctgcaaatcggcgtgtccagc
tataacgcgatctacggcagtttcgcggccttgccgctgttcgtggtctggctgcaaagc
tgttggatcatcgtcttgttcggctgcgagatggcgttttatatccaaaattatccgata
caccgccatggcgaccgtttcggcaatctgagcttttcgttgaagaaaattctggcgctg
caaatcactcatgccctggtcaagcgttttctaaagcaggaggcgccgccctcggccgaa
gaattggcgcgggatttgatgattccgctggctttggtccaggcattgttgaataagttg
atcgccagccgcatcgtcgtcgaattctgccatccggaacaaaccgtctcggtgtttcag
ccggcggtcgatatcaatattctcagtatcggctatgtggtcgatgcgttggaatgctgc
ggccagaaccagttgccggatattcagccgcagcaggattttgccgaagccgtcgaccat
tttcgccaggcgatggcggatagcgcaggtaaccgcttactgaaaaacatttga

DBGET integrated database retrieval system