KEGG   Methylomonas sp. DH-1: AYM39_14905Help
Entry
AYM39_14905       CDS       T04396                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
mdh  Methylomonas sp. DH-1
Pathway
mdh00550  Peptidoglycan biosynthesis
mdh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdh00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AYM39_14905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mdh01002]
    AYM39_14905
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mdh01011]
    AYM39_14905
Enzymes [BR:mdh01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AYM39_14905
Peptidases [BR:mdh01002]
 Serine Peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   AYM39_14905
Peptidoglycan biosynthesis and degradation proteins [BR:mdh01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AYM39_14905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13 Transpeptidase
Motif
Other DBs
NCBI-ProteinID: ANE56340
UniProt: A0A172UAG7
LinkDB All DBs
Position
3375300..3376463
Genome map
AA seq 387 aa AA seqDB search
MSQPLRMTFGLFGGLLLLFTSLSLPAAGPIFTPAAPSAAASSYFLLDFNSSRILAEKDAD
KRVAPASLTKIMTAYVVFRELKAGHLTLDEKVTISQNAWETGGSKMFVEVNKQVRVEDLL
QGMIIQSGNDASVALAEHVAGSEQTFATMMNEQASRLGMANSHFENATGLPSPNHYSSAR
DLALLAQAMIREFPEYYRWDSQKEFTYNGITQQNRNLLLWRDPSVDGLKTGFTDDAGYCM
VASAKREDMRLISVVMGTASANARSNESQSLLNYGFRFFETHRLYEGGKPLAETRIRKGV
TSKLAVGLAEDLYVTAPRKHFNELKAETQIDKGVFAPLNKGDTVGSLNVTLAGDAIASKP
LVALDSVAEGGLFRRLYDAAIGLLEKE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacctcttcgcatgacattcggcctgtttggcgggctgctgttactgttcacc
agcctgtctttgccggccgccggaccgatcttcaccccggccgcccccagcgccgccgcc
tccagttacttcctgctggatttcaacagcagccggattctggccgagaaagacgccgac
aaacgcgtagccccggccagtctgaccaaaatcatgacggcctacgtggtgttccgcgaa
ttgaaggccggacatttaacgttggacgagaaagtcacgatcagccagaacgcctgggaa
accggcggctcgaaaatgttcgtcgaggtcaacaaacaagtccgggtcgaagacttgctg
caaggcatgattatccaatccggtaacgacgccagcgtggccttggccgaacacgtcgcc
ggcagcgagcaaaccttcgcgacgatgatgaacgaacaagccagccgcctgggcatggcc
aacagccatttcgaaaacgccaccggcctgcccagccccaaccattacagctcggcgcgg
gatctggcgctgctggcgcaagcgatgatccgcgagtttccggaatactaccgctgggat
tcgcaaaaagaattcacctacaacggcatcacccaacaaaaccgtaacctgctgttatgg
cgcgatccgtcggtcgacggcttgaaaaccggctttaccgacgacgccggttactgcatg
gtcgcttcggccaaacgcgaagacatgcgcctgatctcagtcgtgatgggcaccgccagc
gccaatgcccgttccaacgaaagccagtcgttgctgaattacggcttccgcttcttcgaa
acccaccgcctgtacgagggcggcaagcctttggccgaaacccgcatccgcaagggcgtg
acttccaaattggcggtcggcttggcggaagacctttacgtgaccgcgccgcgcaaacat
ttcaacgaactgaaagccgaaacccagatcgacaaaggcgtattcgccccgcttaacaaa
ggcgacacggtgggcagtttgaatgtcacgctggctggcgatgcgatcgccagcaaaccg
ctggtggcattggatagcgtggccgaaggcggcctattccgccgcctgtacgacgccgcg
atcggcttactggagaaagaatga

DBGET integrated database retrieval system