KEGG   Methylorubrum extorquens DM4: METDI0497Help
Entry
METDI0497         CDS       T00947                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mdi  Methylorubrum extorquens DM4
Pathway
mdi00061  Fatty acid biosynthesis
mdi00780  Biotin metabolism
mdi01100  Metabolic pathways
mdi01130  Biosynthesis of antibiotics
mdi01212  Fatty acid metabolism
Module
mdi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mdi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    METDI0497 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    METDI0497 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    METDI0497 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mdi01004]
    METDI0497 (fabI)
Enzymes [BR:mdi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     METDI0497 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     METDI0497 (fabI)
Lipid biosynthesis proteins [BR:mdi01004]
 Fatty acid synthase
  Component type
   METDI0497 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: CAX22156
UniProt: C7C9J0
LinkDB All DBs
Position
455485..456315
Genome map
AA seq 276 aa AA seqDB search
MTGLMAGKRGLIMGVANDHSIAWGIAKTLHRHGAELAFTYQGEALGRRVTPLAASVGSDI
VLPCDVEDLATVDAAFATLDERFPDGIDFIVHAIGFSDKAQLKGRYVDVTTRANFSRTMT
ISCFSFTEIAQRAAARMPRGGALLTLTYAGSTRVMPNYNVMGVAKAALEASVRYLASDLG
PDGIRVNALSAGPMRTLAGAGIADARLMYNHQKAHAPLRRTVTLDDVGNSALYLLSDLSG
GVTGEIHFVDSGYNIISMPRPAVLQAQDEAGVVGDL
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacgggtttgatggcgggcaagcgcggcctcatcatgggggtcgccaacgatcattcg
atcgcgtggggcatcgccaagaccctgcaccgacacggcgccgaactcgccttcacctat
cagggcgaggcgctcgggcgccgcgtcaccccgctcgcggcctcggtcggctccgatatc
gtgctgccctgcgacgtcgaggatctcgcgactgtcgatgccgccttcgccaccctcgac
gagcgcttccccgacgggatcgacttcatcgtccacgccatcggcttttccgacaaggcg
cagctcaagggccgctacgtcgacgtcacgacccgcgcgaacttttcgcggaccatgacg
atctcctgcttctccttcaccgagatcgcccagcgcgccgccgcccggatgccgcggggc
ggcgcgctgctgacgctgacctatgccggttcgacccgcgtgatgccgaactacaacgtg
atgggcgtggccaaggccgcgctcgaagcatccgtccgctatctcgctagcgacctcggc
cccgacggcatccgcgtcaacgcgctctcggccggcccgatgcgcacgctggccggcgcc
ggcatcgccgatgcgcggctgatgtacaatcaccagaaggcgcacgccccgctccgacgc
acggtgacgctggacgatgtcggtaactccgcgctctacctgctttcggatctttcgggc
ggcgtgaccggcgagatccacttcgtcgattcgggctacaacatcatctcgatgccccgc
ccggcggtgcttcaggctcaggacgaggcgggcgtcgtcggcgatctgtga

DBGET integrated database retrieval system