KEGG   Methylorubrum extorquens DM4: METDI2309Help
Entry
METDI2309         CDS       T00947                                 

Definition
(GenBank) bifunctional shikimate kinase (N-terminal) / dehydroquinate synthase (C-terminal) enzyme
  KO
K13829  shikimate kinase / 3-dehydroquinate synthase [EC:2.7.1.71 4.2.3.4]
Organism
mdi  Methylorubrum extorquens DM4
Pathway
mdi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01130  Biosynthesis of antibiotics
mdi01230  Biosynthesis of amino acids
Module
mdi_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mdi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    METDI2309
Enzymes [BR:mdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     METDI2309
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     METDI2309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase SKI Fe-ADH_2 Fe-ADH AAA_33 AAA_18 Cytidylate_kin2 AlaDh_PNT_C AAA_22
Motif
Other DBs
NCBI-ProteinID: CAX23911
UniProt: C7CF87
LinkDB All DBs
Position
complement(2200230..2201969)
Genome map
AA seq 579 aa AA seqDB search
MTVPLPPAPPPGEPIEARLRRGLGARSIVLVGLMGAGKSTVGRRLAGRLGLMFKDADHEI
EAAAKLTIADIFSIYGEASFREGEERVIARLLREGPMVLATGGGAFMREATRARIAEGAI
SVWLKADLDVLMRRVRKRNTRPLLQTEDPEATMRTLMEVRHPVYAQADVTVLSREVSHDR
VVEDVMEALDIHINPSHTTQSQHLTFSMTQQPSRVNVPLSGGREYDIRIGRGLIDAVGAE
ARDLGARAAGIVTDETVAGLYGERVRASLEAAGLRCGIIAVPPGEASKSYAEFARVCDGL
LAQKIERGDLVVALGGGVVGDLAGFAAASLRRGVRFLQVPTTLLAQVDSSVGGKTGINSP
LGKNLIGAFHQPRLVLADTAALDTLSEREMRAGYAEVAKYGLIGDAGFFEWCEANWAGIF
SGGPERDEAVAACCRAKAGVVTRDEREDGERALLNLGHTFGHALERLTGYDAARLVHGEG
VAIGLALAFRFSARLGLCPGQDAGRVANHLALAGLPTRLQQVPGGAGDPDALLDAMAQDK
KVRDGQLTFILAHGIGQSFIAPGIDAAEVRAFLETELQG
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtccccctgccgccggcgccgccgcccggcgaaccgatcgaagcacgactgcgc
cgcggcctcggagcccggtcgatcgtgctcgtcggcctgatgggggcgggcaagagcacc
gtcgggcgccgcctcgccgggcgcctcgggctgatgttcaaggatgccgaccacgagatc
gaggcggcggccaagctcaccatcgccgacattttctcgatctacggcgaggcgagtttt
cgcgagggcgaggagcgggtgatcgcgcgtctgctgcgcgaggggccgatggtgctggcc
accggcggcggcgccttcatgcgcgaggcgacgcgggcgcggatcgccgagggggccatc
tcggtctggctcaaggccgacctcgacgtgctgatgcgacgtgtgcgcaaacgcaacacg
cgccctctgctccagaccgaggatccggaggcgaccatgcgcacactgatggaggtgcgc
catccggtctatgcccaagccgatgtcacggtgctgtcccgcgaagtgtcccacgaccgc
gtggtggaggacgtgatggaagctctcgatatccacatcaacccgtctcatacgacacaa
tcacaacatttgacattcagtatgacgcagcaaccctcgcgtgtgaacgttcccctgtcg
ggcgggcgcgaatacgatattcggatcggtcggggtcttatcgacgcggtgggtgcggag
gcgcgggatctcggcgcccgggccgccggcatcgtcaccgacgagacggtcgccggcctc
tacggtgagcgtgtgcgggccagcctcgaggccgccgggttgcgctgcggcatcatcgcc
gtgccaccgggtgaggcctcgaagagctacgcggaattcgcccgcgtctgcgacgggctt
ctggcccagaagatcgagcgcggcgatctcgtcgtggcgctcggcggcggcgtggtcggg
gatctcgccggcttcgcagcggcctccctgcggcgtggtgtccgcttcctccaggttccg
accaccttgctcgcgcaggttgattcctcggtggggggaaagaccgggatcaactcgccg
ctcggcaagaatctgatcggcgccttccaccagccccgcctcgtgctggccgacaccgcc
gccctcgacacgctctcggagcgcgagatgcgggcgggttacgccgaggtcgccaagtac
ggcttgatcggggatgccggcttcttcgagtggtgcgaggcgaactgggccggcatcttc
tccggtgggccggagcgcgacgaggcggtggccgcctgctgccgcgccaaggccggcgtc
gtgacccgcgacgagcgggaggacggcgagcgcgccctgctcaatctcggccacaccttc
ggccacgccctggagcggctgaccggttacgacgcggcccgcctcgtccacggcgagggc
gtcgcgatcggtctggcgctggccttccgcttctcggcccggctcggcctctgccccggc
caggatgcagggcgcgtggccaaccacctcgcgctcgccggcctaccgacccgcctgcaa
caggtgcccggcggggccggcgacccggatgccctcctcgacgccatggcccaggacaag
aaggtccgcgacgggcagctcaccttcatcctcgcccacggcatcggccagagcttcatc
gcgccgggcatcgatgcggcggaggtgcgggccttcctggagacggagttgcagggctga

DBGET integrated database retrieval system