KEGG   Methylorubrum extorquens DM4: METDI3556Help
Entry
METDI3556         CDS       T00947                                 

Gene name
pdhC
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mdi  Methylorubrum extorquens DM4
Pathway
mdi00010  Glycolysis / Gluconeogenesis
mdi00020  Citrate cycle (TCA cycle)
mdi00620  Pyruvate metabolism
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01120  Microbial metabolism in diverse environments
mdi01130  Biosynthesis of antibiotics
mdi01200  Carbon metabolism
Module
mdi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    METDI3556 (pdhC)
   00020 Citrate cycle (TCA cycle)
    METDI3556 (pdhC)
   00620 Pyruvate metabolism
    METDI3556 (pdhC)
Enzymes [BR:mdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     METDI3556 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: CAX25198
UniProt: C7C8Q7
LinkDB All DBs
Position
3492482..3493894
Genome map
AA seq 470 aa AA seqDB search
MPINVLMPALSPTMEKGNLAKWLKKEGDAVKSGDVIAEIETDKATMEVEAVDEGVLAKIL
VAEGTADVPVNELIALIAEEGEDPGSVQAPKGGAEAKIAPVEPKGTPDQNAAPDGSHASY
ARVDQVPEGAKPNGAAQPAGSGDRVFASPLARRIAKQEGVDLSAVKGSGPHGRVIQRDVQ
AAIENGTAKAGAEAKPEAKSEAKSAPAPEKSAPKAAAAGGAPAGLSLDQVKGFYEKGSFE
EVPLDGMRKTIAKRLTEAMQVAPHFYLTVDCELDALMKLRETLNGSAGKDKDGKPLFKLS
VNDFVIKAMGLALTRVPAANAVWAEDRILRFKHAEVGVAVAIDGGLFTPVIRKADQKTLS
TISNEMKDFAGRARAKKLKPEEYQGGVTSVSNLGMFGIKHFTAVINPPQSSILAVGAGEK
RVVVKDGQPTVAQVMTATLSCDHRVLDGALGAELIAAFKGLIENPMGMLV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcaacgtcctgatgcccgcgctctccccgaccatggagaagggcaacctcgcc
aagtggctcaagaaggagggcgacgccgtcaagtccggcgacgtcatcgccgagatcgag
accgacaaggccaccatggaggtcgaggcggtcgatgagggcgtgctcgccaagattctc
gtggccgaaggcaccgccgacgttccggtcaacgagctgatcgcgctgatcgccgaagaa
ggcgaagatccgggcagcgtccaggcgcccaagggtggtgccgaggcgaagattgccccc
gtcgagccgaagggcacgcccgaccagaacgccgcgcccgatggctcccacgcctcctac
gcgcgcgtcgatcaggtgcccgaaggtgccaagccgaacggagcggcgcagccagcaggc
tccggtgatcgcgtcttcgcctcaccgctcgcgcgccgcatcgcgaagcaggaaggcgtc
gatctctcggcggtgaagggctcgggtccgcatggccgcgtgatccagcgcgacgtgcag
gcggcgatcgagaacggcacggcgaaggccggtgcggaggccaagccagaggccaagtcg
gaggccaagagtgctccggcgcccgagaaatccgcgccgaaggcggccgccgcgggcggc
gccccggccgggctcagcctcgatcaggtcaagggcttctacgagaagggcagcttcgag
gaagtgccgctcgacggcatgcgcaagacgatcgccaagcgcctcaccgaggcgatgcag
gtcgcgccgcacttctacctcaccgtcgattgcgaactcgatgcgctgatgaagctgcgc
gagacgctcaacggctcagccggcaaggacaaggacggcaagccgctgttcaagctctcg
gtgaacgacttcgtcatcaaggcgatgggcctcgcgctcacccgcgtccccgccgccaac
gccgtctgggcggaggaccgcatcctgcgcttcaagcacgccgaggtcggcgtcgcggtg
gcgatcgatggcggcctgttcaccccggtgatccgcaaggctgaccagaagacgctctcc
accatctctaacgagatgaaggatttcgctggccgggcgcgcgccaagaagctgaagccc
gaggagtaccagggcggcgtcacctcggtgtcgaatctcggcatgttcggcatcaagcac
ttcacggccgtgatcaacccgccgcaatcgagcatcctcgcggtcggcgcgggcgagaag
cgcgtcgtggtgaaggacgggcagccgaccgttgcccaggtgatgacagcgaccctctcc
tgcgatcaccgcgtcctcgacggcgcgctcggcgctgagctgatcgccgcgttcaagggg
ctgatcgagaacccgatggggatgctcgtctaa

DBGET integrated database retrieval system