KEGG   Methylorubrum extorquens DM4: METDI3716Help
Entry
METDI3716         CDS       T00947                                 

Gene name
ddlB
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mdi  Methylorubrum extorquens DM4
Pathway
mdi00473  D-Alanine metabolism
mdi00550  Peptidoglycan biosynthesis
mdi01100  Metabolic pathways
mdi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mdi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    METDI3716 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    METDI3716 (ddlB)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    METDI3716 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mdi01011]
    METDI3716 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:mdi01011]
 Precursor biosynthesis
  Amino acid ligase
   METDI3716 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_Ter ATPgrasp_ST GARS_A
Motif
Other DBs
NCBI-ProteinID: CAX25355
UniProt: C7CA03
LinkDB All DBs
Position
3655414..3656337
Genome map
AA seq 307 aa AA seqDB search
MSKHVAVLMGGWSSEREISLRSGNACAEALEGEGYRVTRVDVGPDIATVLTELKPDAALN
ALHGPAGEDGTIQGLLEILKIPYTHSGVLASALAMHKERAKTVMRAAGVSVPEGRVVNRH
DAAKSHPLTPPYVVKPIAEGSSMGVIIVRDERSHPPQILASDEWVYGEEVLAETYVAGRE
LTCAVLGDRALGVTEIKPVSGEWYDFDAKYAGGGSIHVLPADLKLNIYQRVQELALTAHQ
ALGCRGVSRADLRYDDTPGGTGALVVLEVNTQPGMTQTSLVPEIAAHAGQSFGELVRWMV
EDASLNR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcacgtcgccgtcctgatgggcggctggtcttctgagcgggaaatctcgctt
cgctccggcaatgcctgcgccgaggcgctggaaggggaggggtatcgcgtcacccgcgtc
gatgtcgggcccgacattgcgacggtgctgaccgagctcaagcccgacgcggcgctcaac
gcgctccacggcccggccggcgaggacggcacgatccagggcctcttggagatcctgaag
atcccctacacccattccggcgtgctggcctcggcgctcgccatgcacaaggaacgtgcc
aaaacggtcatgcgcgcggcaggtgtgagcgttccggagggccgggtcgttaaccgtcat
gatgcggcgaagtcacacccgttaacccctccctatgtcgtgaagccgatcgctgaaggc
tcctccatgggggtcatcatcgtgcgtgacgagcgctcgcacccgccccagattctcgcc
tccgacgagtgggtctacggcgaggaagtccttgcagagacttacgttgccggccgcgag
ctgacctgcgcggtgctgggcgaccgggccctcggtgtgaccgagatcaagcccgtttcg
ggggagtggtacgacttcgatgcgaagtacgccggaggggggtcgatccacgtcctcccc
gcggatcttaaactaaatatttaccagcgtgtccaagagttggcgttaacggcgcatcaa
gcactgggatgtcgtggcgtcagccgtgccgaccttcgttacgacgacacgccgggtgga
accggcgctctcgtcgtcctcgaggtcaacacgcagccagggatgacccagacgagcctt
gtgccggagatcgcggcccacgcaggccagagtttcggtgaactcgtccgatggatggtg
gaggacgcttctctcaaccgctga

DBGET integrated database retrieval system