KEGG   Methylorubrum extorquens DM4: METDI4227Help
Entry
METDI4227         CDS       T00947                                 

Gene name
aldA
Definition
(GenBank) aldehyde dehydrogenase, chloroacetaldehyde dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mdi  Methylorubrum extorquens DM4
Pathway
mdi00010  Glycolysis / Gluconeogenesis
mdi00620  Pyruvate metabolism
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mdi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    METDI4227 (aldA)
   00620 Pyruvate metabolism
    METDI4227 (aldA)
Enzymes [BR:mdi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     METDI4227 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: CAX25858
UniProt: C7CDU4
LinkDB All DBs
Position
4163777..4165300
Genome map
AA seq 507 aa AA seqDB search
MNKPEFLADAKTKSPFSARYDNFIGGQWVAPASGRYFENTSPITGKVICEVARSEAADIE
RALDAAHAAKDAWGRTAPAERARILNKIADRMEDNLDLIALAETWDNGKPIRETTAADIP
LAIDHWRYFASCVRAQEGAISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAI
AAGNCVVLKPAEQTPASILVVMELIGDLLPPGVINVVNGFGLEAGKPLASNPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFGDVVNEDDDFFDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFIERAIKRVEAITQGSPLDPATMIGAQASSEQLEKILSYVDIG
RQEGAECLTGGARGTREGDLADGFYMQPTVFKGHNKMRIFQEEIFGPVLSVTTFKDDEEA
LSIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNMLVSYSSKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagcccgaattcctggcggatgccaagacgaagtcgccgttttcggcgcgctac
gacaacttcatcggcggccagtgggtcgcgccggcgagcggccgctacttcgagaacacc
tcccccatcaccggcaaggtgatctgcgaggtcgcccgctccgaggcggcggacatcgag
cgggcgctcgacgccgcgcacgccgccaaggatgcctggggccgcaccgcgccggccgag
cgcgcccgcatcctcaacaagatcgccgaccggatggaggacaacctcgatctgatcgcg
ctggccgagacctgggacaacggcaagccgatccgcgagaccaccgccgccgacatcccg
ctcgccatcgaccactggcgctacttcgcgagctgcgtccgcgcccaggaaggcgcgatc
tccgagatcgaccacgacacggtggcctaccatttccacgagccgctcggcgtcgtcggc
cagatcatcccgtggaacttcccgatcctgatggcggtgtggaagctggctcctgcgatc
gccgccggcaactgtgtggtgctcaagcccgccgagcagacccccgcctcgatcctcgtg
gtgatggagctgatcggcgacctgctgccgcccggcgtcatcaacgtcgtcaacggcttc
ggcctggaggccggcaagccgctcgcctcgaacccgcgcatcgccaagatcgcgttcacc
ggtgagacgaccaccggccgcctcatcatgcagtacgcctcgcagaacctgatcccggtg
acgctggagctcggcggcaagtcgccgaacatcttcttcggggatgtcgtcaatgaggac
gacgacttcttcgacaaggcgctcgaaggcttcaccatgttcgccctcaaccagggcgaa
gtctgcacctgcccgagccgcgcgctcgtgcacgagtcgatctacgaccgcttcatcgag
cgcgcgatcaagcgcgtcgaggcgatcacccagggctcgccgctcgatccggcgacgatg
atcggcgcgcaggcgtcttcggagcagctcgagaagattctcagctacgtcgatatcggc
cgccaggaaggcgccgagtgcctcacgggcggcgcccgcggcacccgcgagggcgatctg
gccgacggcttctacatgcagccgacggtgttcaagggccacaacaagatgcggatcttc
caggaggagatcttcgggcccgtcctctcggtcacgaccttcaaggacgacgaggaggcg
ctctccatcgccaacgacacgctctacggcctcggcgccggcgtgtggacccgcgacgga
acccgcgcctaccgcttcggccgcgccatccaggccggccgcgtctggacgaactgctac
cacgcctacccggcgcacgcggccttcggcggctacaagcagtccggcatcggccgtgag
acccacaagatgatgctcgaccactaccagcagaccaagaacatgctggtcagctactcc
tcgaagaagctcgggttcttctaa

DBGET integrated database retrieval system