KEGG   Methylorubrum extorquens DM4: METDI4749Help
Entry
METDI4749         CDS       T00947                                 

Definition
(GenBank) conserved hypothethical protein; putative chromosome segregation ATPase-like protein
Organism
mdi  Methylorubrum extorquens DM4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4201 MscS_porin ADIP Baculo_PEP_C Spc7 ERM APG6_N GAS HMMR_N
Motif
Other DBs
NCBI-ProteinID: CAX26370
UniProt: C7CH70
LinkDB All DBs
Position
4645655..4646959
Genome map
AA seq 434 aa AA seqDB search
MAIDFRSELRRPFTLSLAALAIVLFVWLLIVTVVHARQRRAYEAQLAMQMQGQIALQNEF
NQQRSALGSISELQEKVALIEAQRRRGSELVAQAVAQVASLKEDQAAAETRAAEARKAAE
QEARRLADLEAQAQKLEPLRQAVSEAEQTAATRMQGLSDLDRMIEAARQQEGKLRGDLEG
LSRKIETKTTNLAKIDQSQQQLHAAAESAQKEFSEAKAASDQANTSKRETENALNELRGR
SEQITNAITQDSQQLEQVRRDLTAAQADLSRSQNQRDKFAAERTELEASVSAQLARQNEL
TAALKSSQQELQTQRDALSVMRQETERSRSEHDRITTERAQAQEVVNKLRADQERYVSEL
NALKKQQAEVQAQLATTTENIAARNKDIADLEGRLGSTRKELADTQSKLAETRQQLSGQP
APDGTPPEAPPSSR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgattttcgctcggagctgcgtcgcccattcacgctcagccttgcggctctg
gctatcgtccttttcgtctggttgctgatcgtcacggtggttcatgccaggcagcgtcga
gcctatgaggcgcaacttgcaatgcaaatgcaagggcagatcgcactccaaaacgagttc
aaccagcagcgcagtgccttaggatctataagcgagttacaggagaaggttgccctaatc
gaagctcaaagacggcgcggcagcgagttggtcgctcaagctgtggcccaggtagcatcc
ctcaaggaggatcaggctgcggcggagacgcgtgcggcagaggcaaggaaagccgcggag
caagaagcccgtcgcctagcagaccttgaagcgcaggcacaaaagctcgaaccgctccga
caagcagtctccgaggctgagcagactgcggctacccgcatgcaggggctttcagacctt
gaccgtatgatcgaagcggctcgccagcaggagggcaagctacggggcgaccttgagggt
ttgtcgcgcaagatcgagacgaaaaccactaatttagctaagatcgatcaatcacagcag
caacttcatgcggccgctgaatctgctcagaaggagttctctgaagcaaaagctgcaagc
gatcaggccaacacctcgaagagagagacggaaaatgcacttaacgaactgagaggcaga
agcgagcaaattaccaatgcgataactcaagacagtcagcaactagagcaggtccgccgg
gatcttactgcagcgcaggcggacctcagccgcagtcaaaatcagcgggataagttcgca
gctgagcgtactgaacttgaagcctcagtcagcgctcaattagcgagacagaacgaactc
accgctgcgctcaaaagcagtcagcaggagcttcagactcagcgcgatgcactctctgtg
atgaggcaggaaacggagcgatcacggtctgagcacgaccgcattactaccgagcgagcc
caagctcaagaagtagttaacaagttgcgagccgaccaggaacgctatgtctctgagctg
aacgccttgaaaaagcagcaggctgaggtgcaagcgcagctcgcaactaccactgagaac
attgctgctcgcaacaaagatatagctgatctagaggggcgccttggatctacgcgtaag
gagcttgcagacactcagagcaaacttgctgagacccgtcagcaattatcagggcaacct
gctccggacggcactccacccgaagctccgccatcttcaaggtaa

DBGET integrated database retrieval system