KEGG   Methylorubrum extorquens DM4: METDI5295Help
Entry
METDI5295         CDS       T00947                                 

Gene name
fabI
Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mdi  Methylorubrum extorquens DM4
Pathway
mdi00061  Fatty acid biosynthesis
mdi00780  Biotin metabolism
mdi01100  Metabolic pathways
mdi01130  Biosynthesis of antibiotics
mdi01212  Fatty acid metabolism
Module
mdi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mdi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    METDI5295 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    METDI5295 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    METDI5295 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mdi01004]
    METDI5295 (fabI)
Enzymes [BR:mdi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     METDI5295 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     METDI5295 (fabI)
Lipid biosynthesis proteins [BR:mdi01004]
 Fatty acid synthase
  Component type
   METDI5295 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: CAX26908
UniProt: C7CLQ9
LinkDB All DBs
Position
complement(5227583..5228410)
Genome map
AA seq 275 aa AA seqDB search
MSEQKPGGLLAGKRGLVLGVANNRSIAWGIARSAAAHGAELAFTYQGEALKKRVEPLARE
LNAHVVGHCDVTDPASIDSAFAATAEVFPDGIDFVVHCIAFSDKDELTGRYLETSEANFT
KSLLISCYSFTAVAQRAEKIMRNGGSMLTLTYYGAEKWMPHYNVMGVAKAALEASVRYLA
ADLGPKQIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPMRRTVTIEEVGETAAYLFS
DMSRGMTGEILHVDAGYHVVGMKNPDAPDITRERE
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaacagaagccgggcgggctgctcgcgggcaagcgcgggctggtgttgggagtg
gccaacaaccgctcgatcgcctggggtatcgcccgtagcgctgccgcgcacggggcggaa
ttggcgttcacctaccagggcgaggcgctgaagaagcgcgtcgagccgctggcgcgcgag
ttgaacgcgcatgtcgtcggccattgcgacgtcaccgatcccgcctcgatcgattccgcc
ttcgccgcgaccgccgaggtgttcccggacgggatcgatttcgtcgtccactgcatcgcc
ttctccgacaaggacgagctgacggggcgctatctcgagacctcggaggcgaacttcacc
aagtcgctgctgatctcgtgctactcgttcacggcggtggcgcagcgcgcggaaaagatc
atgcgcaacggcgggtcgatgctgaccctgacctattacggcgccgagaagtggatgccc
cactacaacgtgatgggcgtcgccaaggccgcgctggaagcctccgtgcgctacctcgcc
gccgatctcgggccgaagcagatccgcgtcaacgcgatctcggccgggccgatcaagacg
ctggcggcctccggcatcggcgacttccgctacatcctcaagtggaacgagtacaacgcg
ccgatgcgccggaccgtgaccatcgaggaggtcggcgagacggcagcctacctgttctcc
gacatgtcccgcggcatgaccggcgagatcctccacgtcgatgccggctaccacgtcgtc
ggcatgaagaaccccgacgcaccggacatcacccgcgagcgggaatag

DBGET integrated database retrieval system