KEGG   Methylobacterium extorquens DM4: METDI5427Help
Entry
METDI5427         CDS       T00947                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu (EF-Tu)
  KO
K02358  elongation factor Tu
Organism
mdi  Methylobacterium extorquens DM4
Brite
Translation factors [BR:mdi03012]
 Eukaryotic Type
  Elongation factors
   METDI5427 (tuf)
 Prokaryotic Type
   METDI5427 (tuf)
Mitochondrial biogenesis [BR:mdi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    METDI5427 (tuf)
Exosome [BR:mdi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   METDI5427 (tuf)
  Exosomal proteins of breast cancer cells
   METDI5427 (tuf)
  Exosomal proteins of colorectal cancer cells
   METDI5427 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: CAX27036
UniProt: C7CMP1
LinkDB All DBs
Position
complement(5370320..5371510)
Genome map
AA seq 396 aa AA seqDB search
MAKEKFSRTKPHCNIGTIGHVDHGKTSLTAAITKVLAESGGATFTAYDQIDKAPEEKARG
ITISTAHVEYETTNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFLNKVDMVDDEELLELVELEVRELLSKYDFPGDDIPITKGSALMALE
DKEPKIGKEAVLALMATVDEYIPQPERPIDMPFLMPIEDVFSISGRGTVVTGRVERGIVK
VGESVEIVGIRPTTTTTVTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVVCKPGS
VKPHSKFKAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGVCTLPEGTEMVMPGDNVT
MDVVLIVPVAMEEKLRFAIREGGRTVGAGVVAAIND
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagttctcccgtaccaagccgcactgcaacatcggcacgatcgggcac
gtggatcacggcaagacgtcgctgacggcggcgatcacgaaggttctggcggagtcgggc
ggggcgaccttcacggcatacgaccagatcgacaaggcgccggaggagaaggcgcgcggc
atcacgatctcgaccgcccacgtcgagtacgagacgaccaaccgccactacgcgcacgtc
gactgccccggccacgccgactacgtgaagaacatgatcaccggtgccgcccagatggac
ggcgcgatcctggtcgtgtccgccgccgacggcccgatgccgcagacccgcgagcacatc
ctgctcgcccgtcaggtcggcgtgccggcgctggtggtgttcctcaacaaggtcgacatg
gtcgatgacgaggagctgctggagctggtcgagctggaggtgcgcgagctcctctccaag
tacgacttccccggcgacgacatcccgatcaccaagggctcggccctgatggcgctcgag
gacaaggagcccaagatcggtaaggaagccgttctggcgctgatggcgacggtggacgag
tacatcccgcagccggagcgtccgatcgacatgccgttcctgatgccgatcgaggacgtg
ttctcgatctcgggccgcggcacggtggtgaccggtcgcgttgagcgcggcatcgtcaag
gtcggtgagtcggtggagatcgtcggcatccgtccgacgacgacgacgacggtgaccggc
gtcgagatgttccgcaagctgctcgaccagggtcaggcgggcgacaacgtcggcgtgctg
ctgcgtggcacgaagcgcgaggacgtggagcgcggccaggtcgtgtgcaagcctggttcg
gtgaagccgcactcgaagttcaaggccgaggcctacatcctgacgaaggaggagggcggc
cgccacacgccgttcttcaccaactaccgcccgcagttctacttccgcacgacggacgtg
accggcgtgtgcacgctgcccgagggcaccgagatggtgatgccgggcgacaacgtgacc
atggacgtggtgctgatcgtgccggtggccatggaagagaagctgcgcttcgccatccgc
gagggtggtcgcaccgtcggtgccggcgtcgtcgccgccatcaacgactga

DBGET integrated database retrieval system