KEGG   Methylorubrum extorquens DM4: METDI5532Help
Entry
METDI5532         CDS       T00947                                 

Gene name
nrtB
Definition
(GenBank) Nitrate transport permease protein
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
mdi  Methylorubrum extorquens DM4
Pathway
mdi00910  Nitrogen metabolism
mdi02010  ABC transporters
Module
mdi_M00438  Nitrate/nitrite transport system
mdi_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:mdi00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    METDI5532 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    METDI5532 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mdi02000]
    METDI5532 (nrtB)
Transporters [BR:mdi02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter [MD:M00438] [OT]
    METDI5532 (nrtB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: CAX27138
UniProt: C7C7L2
LinkDB All DBs
Position
complement(5495774..5496634)
Genome map
AA seq 286 aa AA seqDB search
MMATGATLTATRERAAKARTPFITLAGLRGVAARVLPPLVVLAGFLLLWEVLCSSPTAGL
PPPSRVVTEAWDIIIDPFYDNGGTDKGLFWHIAASLKRVALGFSLAVVAGVMLGTLVGQS
DWAMRGLDPIFQILRTIPPLAWLPLSLAAFRDGQPSAIFVIFITSIWPIIINTAVGIRNI
PQDYRNVAAVIRLNPIEFFVKIMLPSAAPYIFTGLRIGVGLSWLAIVAAEMLIGGVGIGF
FIWDAWNSSHISEIIVALVYVGLIGFVLDRMVAGLGVLVTRGTSAA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
gtgatggctaccggagcaacgctcaccgcaacccgcgaacgcgccgccaaggcccgcacg
cccttcatcaccctggccgggctgcgcggcgtcgccgcccgcgtcctgccgccgctcgtc
gtcctggcgggcttcctgctcctgtgggaggtgctgtgctcctcccccaccgccggcctg
ccgccgccctcgcgggtggtgacggaagcctgggacatcatcatcgatccgttctacgac
aacggcggcaccgacaagggcctgttctggcatatcgccgcgagcctgaagcgcgtggcg
ctgggcttctcactggcggtggtggcgggcgtgatgctcggcacgctggtcggccagtcc
gactgggcgatgcgcggactcgacccgatcttccagatcctgcgcacgatcccgccgctg
gcctggctcccgctctcgctggctgccttccgcgacggtcaaccgagcgcgatcttcgtg
atcttcatcacctcgatctggccgatcatcatcaacaccgcggtcggcatccgcaacatt
ccgcaagactaccgcaacgtcgccgcggtcatccggctgaacccgatcgagttcttcgtg
aagatcatgctgccctcggcggccccctacatcttcaccggtcttcgcatcggcgtcggc
ctgtcctggctcgccatcgttgcggccgagatgctgatcggcggcgtcgggatcggcttc
ttcatctgggatgcgtggaactcgtcgcacatttccgagatcatcgtcgccctcgtctat
gtcgggctcatcggcttcgtcctcgaccggatggtcgccgggctcggcgtgctcgtgacc
cgcggcaccagcgcagcgtga

DBGET integrated database retrieval system