KEGG   Microplitis demolitor: 103570957Help
Entry
103570957         CDS       T05600                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mdl  Microplitis demolitor
Pathway
mdl00020  Citrate cycle (TCA cycle)
mdl00190  Oxidative phosphorylation
mdl01100  Metabolic pathways
mdl01200  Carbon metabolism
Module
mdl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mdl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mdl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103570957
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103570957
Enzymes [BR:mdl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103570957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA DAO FAD_binding_3 HI0933_like Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 103570957
NCBI-ProteinID: XP_008547098
LinkDB All DBs
Position
Unknown
AA seq 659 aa AA seqDB search
MSGLLKLSSLLSGQPARVLNKLGLPAVTNRNFHYTPDGKAKTSEAISKQYPVVDHTYDAV
VVGAGGAGLRAAYGLVAEGFKTAVITKLFPTRSHTVAAQGGINAALGNMEEDNWQWHMYD
TVKGSDWLGDQDAIHYMTREAPKAVIELENCGMPFSRTQDGKIYQRAFGGQSLKFGKGGQ
AHRCCCVADRTGHSLLHTLYGQSLSYDCNYFVEYFALDLLMEGGECRGVIALCLEDGSIH
RFHSKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVTRAGLPNQDLEFIQFHPTGIYGAGC
LITEGSRGEGGYLINSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGVGPEKDHIY
LQLHHLPPEQLAARLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYKGQVLTTK
NGEDVVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACAITISQENKPGEKIGPLS
SNAGEESVANLDHIRHANGSVSTADLRLNMQKTMQTHAAVFREEKTLQDGCRKMTDIYKK
LDDLKVTDRSLIWNSDLIETLELQNLMLNAMQTIYAAENRKESRGAHAREDYKDRIDEYD
YSKPLAGQQPKPIDQHWRKHTLTKMDAKSGKVSIDYRPVIDATLDNQECATVPPAIRSY
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgagcggattattaaagctctcgagtcttctctcaggacaacccgctcgagttctgaat
aaattagggctaccagcagtaacgaatcgtaattttcattacacaccggacggaaaagcc
aagacttcggaagcgatatccaagcagtacccagtggtagatcacacgtacgatgcagtg
gtggtgggagcaggaggagcgggactgagagcagcgtacggtcttgtagcagaaggattt
aaaacagcagtaattactaaattatttcccactcgatcgcacactgtcgctgctcaaggt
ggaatcaatgcggctctgggtaacatggaagaagacaactggcagtggcacatgtacgac
accgtcaagggctcggactggcttggtgaccaagatgccattcattacatgacacgtgaa
gctccgaaggctgtcattgaattagaaaattgcggtatgccattcagccgaacccaggat
gggaaaatatatcagcgagcattcggtgggcagtctttgaaattcggcaaaggaggacag
gcacacagatgttgctgtgtcgccgacagaaccggacactcgttgctccacacactctac
ggacagtcattgagttatgactgcaattattttgtcgagtactttgctctagatttgttg
atggaaggcggagaatgtcggggagtgatagcgctgtgccttgaagatggctcgatccat
cgtttccactcaaagaatactgttctcgcaactggtggctatggacgggcttacttttca
tgtacgtctgctcacacgtgcactggagacggcacagcgatggtcacacgtgctggtctt
cctaatcaagacttggagttcatacaattccacccgacaggaatttatggggctggatgt
ttgattactgagggaagtcgtggtgaaggtggttatttaattaacagcgaaggtgaacga
tttatggaacgttacgctccagtggctaaagatttagcctcgcgtgacgttgtttcgagg
tcgatgaccattgaaatccgtgagggacgtggcgttggaccggagaaagaccacatttac
cttcaattacatcatttgccaccagaacaattggccgctaggcttccgggtatctcggag
actgcgatgatcttcgctggagtcgatgtcactcgcgagcccatcccagtattgcccacg
gtgcattacaatatgggtggagtgcctactaattacaagggacaagtattgacgaccaag
aacggcgaagatgtcgttgtacctggactctatgcctgtggagaagctgcctctgcgtca
gtacacggcgcgaaccgacttggtgccaattctctactagatctggttgtgtttggccgt
gcctgcgcgattactatttcacaggagaacaaacctggtgaaaaaataggtccacttagt
tcgaatgctggagaagaatccgttgcgaacttggaccatattagacatgcaaatggatca
gtttcgactgctgacttgagattgaatatgcagaagactatgcaaactcatgccgctgtt
tttagagaggaaaagactcttcaagacggctgccgcaaaatgactgacatctacaagaaa
ttagacgaccttaaagtaactgaccggtcgttaatttggaactcagacctgatcgagact
ttggagcttcaaaatctcatgctcaacgccatgcaaacaatttacgcggctgaaaacagg
aaggaaagtcgcggagctcatgcccgagaggattacaaggacagaattgatgagtacgac
tacagtaagcccttggcaggccagcaaccgaagccaatagatcaacattggagaaagcac
acgctcacgaaaatggatgcgaaatccggaaaagtatccattgactatcgacctgtaatc
gacgcaactcttgataatcaggaatgcgcaacggtaccacctgcaattaggtcgtactaa

DBGET integrated database retrieval system