KEGG   Microplitis demolitor: 103571148Help
Entry
103571148         CDS       T05600                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mdl  Microplitis demolitor
Pathway
mdl00020  Citrate cycle (TCA cycle)
mdl00190  Oxidative phosphorylation
mdl01100  Metabolic pathways
mdl01200  Carbon metabolism
Module
mdl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mdl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mdl_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103571148
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103571148
Enzymes [BR:mdl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103571148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO HI0933_like Thi4 FAD_binding_3 GIDA FAD_oxidored
Motif
Other DBs
NCBI-GeneID: 103571148
NCBI-ProteinID: XP_008547417
LinkDB All DBs
Position
Unknown
AA seq 652 aa AA seqDB search
MFNPTVSRTLIKSLCKKLFKPRNLHVNINLSDKSSDIKCSYPMIDHCYDVVVVGAGGAGL
RAAVGLGSKGYRVAVVTKLFPTRSHTVAAQGGINAAINNSEQDQDDWLFHMYDTVKSSDW
LGDQDAIHYLTREAPQAVYELENYGCPFSRTADGKIYKRAFAGQSLNFGKGGQARRTCSA
ANRTGHAILQTLYGQSLKYNVDYYVEFFALDLLMDGRICRGVIAWELETGMIHRFRAHHT
VLATGGAGRCFFSCTSAHTCTGDGAAMVSRAGIPLQDMEFIQFHPTGLYGSGVLITEGCR
VEGGKLVNSAGEFFMDKYAPKAKDLASRDVVSRAIAIEIFEGRGVGKKKDHVYLQLNHLP
AETIRLKLPGVSHLAWVFTGVNCEKEPIPVVPTAHYNMGGIPTNWRGQVLTRDNEEDKPV
EGLWAAGEAACTSVHGANRLGANSLLEIIVFGRAVAENISTVLNPEQEHQNISPDLGNET
LRRFDKTRYAKGSISVGNLREEMQMTMQKYCGVFRTCSVLQRGCTEITRLYINLLSEIKM
LDNSVIWNTELLEALELQNMMLFNMHTVYAAENRRESRGAHARDDFPDRIDEYDYKLPLE
GQKRKSLTHHWRKHTLTWALANGSICISYRPVIDTTLDQSEAQHVPPAIRVY
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtttaatcctacagtatctcgtactttaatcaaaagtttatgtaaaaaactatttaag
ccgcgtaatttacatgtcaacattaatttatctgataaatcatctgatataaaatgtagc
tacccgatgatcgatcactgttatgatgtagtggtagtaggagccggtggagccggactg
cgagcagcagtcggtctaggaagcaaaggctaccgggttgcggttgtaacaaaattattt
cccactagatctcatactgttgcggctcagggtggaattaatgccgcgataaataattct
gaacaagaccaagatgattggttatttcatatgtacgacactgtaaaaagttcagactgg
cttggagatcaggatgctattcattatttgacacgtgaagctcctcaggctgtttatgaa
ttagaaaattatggttgcccttttagtcgaacagcggatggtaaaatttataaacgagcg
ttcgcaggacagtctctcaattttggtaaaggaggacaagctcgcagaacttgttcggca
gcaaaccgcacagggcacgcaattttgcaaactctttacggccaaagtttgaaatataac
gttgattattacgttgaatttttcgcacttgatttactgatggatggaagaatttgtaga
ggcgtaattgcatgggaactggagacgggaatgatccatcgcttccgtgctcatcacaca
gttttggcaactggtggagctggtagatgttttttttcctgcactagtgcccatacttgt
accggagacggagccgcgatggtctctcgtgcaggtattccgctgcaagacatggaattt
attcaattccatcccacaggactctacggaagcggggttttgattactgaaggctgtcgt
gtagaaggtggaaagctggttaattctgcgggagagttttttatggacaaatatgcaccc
aaagctaaagatttagcatcgcgtgacgtagtttcccgggctatcgcgatcgaaatcttc
gaaggaagaggagtggggaaaaaaaaagatcatgtgtacttacaactaaatcatttgcct
gctgaaacgataagacttaaattaccaggagtttcacatctagcctgggtatttacaggt
gttaattgtgaaaaggaacctattcctgtagttccgactgctcattataatatgggagga
atcccgaccaattggcgtggccaagtactgactagagacaatgaagaagataaaccagta
gaaggtctctgggcagcaggcgaagccgcctgtacttcagttcatggagcgaatcgtctt
ggagccaatagtcttttagaaataattgtgttcggtcgtgcagttgctgaaaacatcagc
actgtcctcaatcccgaacaagagcatcagaatatttctccagacctgggaaatgaaacg
ctgcggcgttttgataaaactcgttatgcaaaaggttcaatttccgttggtaatttacga
gaagaaatgcagatgacgatgcaaaaatattgtggagttttccgaacttgttcagtttta
caaagaggctgtacagaaataactcgactctacataaatttattatcagaaattaaaatg
cttgataattctgttatctggaatactgaactactagaggcattagaattacaaaacatg
atgttatttaatatgcatactgtttacgcagctgaaaatcgtagagaatcaagaggagct
catgcgcgtgatgattttcctgatcgcatagacgagtacgattataaattaccattggaa
ggccagaaaagaaaatctttaactcatcattggagaaagcacacgctgacatgggctctg
gccaacggctcaatttgcatttcttatcgcccggtcattgacacaacgctcgatcagtca
gaagctcaacatgtgccccctgccatacgcgtttattaa

DBGET integrated database retrieval system