KEGG   Microplitis demolitor: 103575154Help
Entry
103575154         CDS       T05600                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mdl  Microplitis demolitor
Pathway
mdl03030  DNA replication
mdl03410  Base excision repair
mdl03420  Nucleotide excision repair
mdl03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    103575154
   03410 Base excision repair
    103575154
   03420 Nucleotide excision repair
    103575154
   03430 Mismatch repair
    103575154
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mdl03032]
    103575154
   03400 DNA repair and recombination proteins [BR:mdl03400]
    103575154
Enzymes [BR:mdl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     103575154
    6.5.1.6  DNA ligase (ATP or NAD+)
     103575154
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     103575154
DNA replication proteins [BR:mdl03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    103575154
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     103575154
DNA repair and recombination proteins [BR:mdl03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     103575154
   NER (nucleotide excision repair)
    Other NER factors
     103575154
   MMR (mismatch excision repair)
    Other MMR factors
     103575154
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C mRNA_cap_enzyme DCB
Motif
Other DBs
NCBI-GeneID: 103575154
NCBI-ProteinID: XP_008553041
LinkDB All DBs
Position
Unknown
AA seq 947 aa AA seqDB search
MAQRSITSFFKRTTTSEDKNDSSQKKNDRLDDSTEDCGKRKRNSDVNTSNSESPPAKKPD
TKTTKPRARKPKASPKLTNKSKSKETLNKLSFAKETPKKISTDENSSNGISKKKLNGSDT
KESAKKRSRALMSDLSDDEGHLPLPVTPEKSKKVDGDEVSENPSSPDKSKDNEKSPEKSN
GKKSPIKTEDLKNSPEKSKEKSDDTESPQESSDEEKPNAKLQRSRLRIVDTDSESEEESL
PVDKTPTKDIRNFFSKPAKKNPTKVEKSKSNLFSKQDKNSQDSKSEQHNTPDSYNPLMDK
YHPILNACWTKGQKTPYIALTRTLELIEQTSSRLKIVEILSNYLRSVIVLSPEDLLPSIY
LCLNQLAPAYEGLELGVAETTLIKAIAQCTGRTPAQIKADAQEAGDLGIVAEGSRSNQRV
MFQPAALTVGTVYAKLKEIAQSTGTASVGKKVDRIQSLFVACRFTEARYLIRSLAGKLRI
GLAEQSVLQALALACAMTPPNQEYPPEILDGSKKMSSDEFKKKYDAIALIIKTTYCECPN
YGMIIPVLLKDGVEALPDKCKLTPGVPLKPMLAHPTKGVQEVLKRFDGLKFTCEWKYDGE
RAQIHISDDGKAYIFSRNQENNTSKYPDIIGRLSNTRGDDVKSCILDCEAVAWDRENKQI
LPFQILSTRKRKDANEADIKVQVCVFMFDLLYFNGEPLVKKPFAKRRELLKKNFKEVEGE
WYFATSLDTTTMEEVQEFLDVSVKGNCEGLMVKTLEEDATYEIAKRSRNWLKLKKDYLEG
IGDTLDCVVIGGYIGKGKRTGTYGGFLLACYDSDNEEYQSLCKIGTGFSEEDLQKHTALL
KEHLIPAPKSYYRYDSSHEPDHWFEPTQVWEIKCADLSLSPVHRAAAGIVDPVKGISLRF
PRFIRVRDDKKAEDASSAQQVAEMYKGQEQIINQQPSSSALNEEDFY
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcgttctataacatcattttttaaaagaaccacaacttcggaggataaaaat
gactcaagtcaaaagaaaaatgacagactcgatgattcaactgaagattgcggaaaaaga
aagaggaatagtgatgtcaataccagtaattctgaatctccacctgctaaaaagccggac
accaaaactacaaaacccagagcgcgaaaacccaaagcatctccaaaattaacaaataaa
tctaaaagtaaagagacgttgaataaattgtcattcgccaaagaaacccctaaaaaaatt
tctactgatgaaaattcatcaaatggaatttctaaaaaaaaattaaatggaagcgataca
aaagaatcagctaaaaaacgttcacgagctttgatgtctgacttaagtgatgacgagggt
catttgccgttacctgttacgccagagaagtctaaaaaagttgacggtgatgaagtatct
gaaaatccatcatctccagataaatctaaagacaatgaaaagtctccagaaaaatccaat
ggtaaaaaatctccaataaaaactgaagatttaaaaaattctccagaaaaatctaaagaa
aaatctgatgatacagaaagccctcaagagtcttctgacgaagaaaaaccgaatgcaaaa
cttcaaagatcgcgattaagaatagttgatactgattctgaatctgaagaagaatcatta
ccagttgacaagacacctacaaaagacatccgcaatttcttttcaaagccagcgaagaaa
aatcctactaaggttgaaaaatcaaagagcaatttattcagcaagcaggataaaaattcc
caggacagtaaatctgagcaacacaatacccctgactcctataatcctctaatggacaaa
tatcacccgattttaaatgcctgctggaccaaaggacagaagactccatacatagccctg
acccgtacccttgaactgattgagcaaacgagctcgcggctgaagatcgttgaaatttta
tcaaattacttgaggtcagttattgttttgtcacctgaagatttattacccagcatttac
ttgtgtctcaatcaattggcgccagcctacgaaggtctcgaactaggagtcgctgagaca
acgttaataaaagctattgcgcagtgcactggccgtacaccagcgcaaataaaagcagat
gcacaagaagccggtgatttgggaatcgtcgctgaaggcagtcggtccaatcagcgggtg
atgttccaacctgcggcactcactgtaggaactgtctatgcaaagttgaaagaaatcgct
caatcaacaggaactgcctcggtaggaaaaaaagttgatcgtattcagtctctgttcgtc
gcttgtcggttcacggaagctcgttacctcatcagatcacttgctggtaaacttaggatc
ggtttagctgagcagtcagtcctgcaagcgctcgctcttgcttgcgcgatgactccgcct
aatcaggagtacccgccggagattctagacggcagtaaaaaaatgtccagtgatgagttc
aagaaaaagtacgacgcgattgcgttgattatcaagacaacgtactgcgagtgtcccaat
tatggaatgattattccggtattattgaaagatggtgtcgaagcattgccggataaatgt
aagctaacaccgggagtcccattgaaaccgatgctggctcatccaacgaaaggtgtccag
gaagtactgaaacgttttgacggtttgaaattcacttgcgagtggaaatatgacggagag
agagcgcaaattcatatatctgatgatgggaaggcttacattttcagtcgcaaccaggaa
aataatacatctaagtacccagatatcattggacggctgagtaacactcgtggtgatgac
gtcaaaagttgtattttagattgcgaagctgttgcttgggatcgggagaacaaacaaatt
ttgccgtttcaaattttaagtacgagaaaacgtaaagatgctaatgaggcggacataaag
gtccaggtttgtgtatttatgttcgatttgttgtatttcaatggcgagcctttggtgaaa
aaaccctttgccaaacgacgtgagctgctgaagaaaaattttaaagaagttgaaggcgag
tggtattttgctacaagtcttgacacgacgaccatggaagaagtccaagagtttttagat
gtttctgttaaaggaaactgcgaaggtctgatggtcaaaactctggaggaagatgctact
tatgaaatcgccaagagatcgaggaattggttgaaattgaagaaagattatcttgaaggt
attggtgacacgctggactgtgtcgtcattggaggatatattggcaaaggcaaacgtact
ggtacttacggaggatttttgctcgcttgttatgattctgataatgaagagtatcaaagt
ctttgcaagattggcactggatttagtgaagaagatctccaaaaacatacggcattatta
aaagaacatttaattcctgcaccaaaatcttattaccgctatgactcgtctcatgaacca
gatcattggttcgaaccaacccaagtctgggaaataaagtgcgctgatttatcattatca
ccagtccatcgagccgcagctggaatagttgatccagtcaaaggaatatccttaagattt
cctcggttcattcgcgtacgcgatgacaaaaaagctgaggatgcatcatcggcacagcag
gtggctgagatgtacaagggtcaagagcagataattaatcaacagccatcgagttctgca
ttaaatgaagaagatttttattaa

DBGET integrated database retrieval system