KEGG   Microplitis demolitor: 103576574Help
Entry
103576574         CDS       T05600                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mdl  Microplitis demolitor
Pathway
mdl04146  Peroxisome
mdl04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    103576574
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    103576574
Enzymes [BR:mdl01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103576574
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-GeneID: 103576574
NCBI-ProteinID: XP_008555080
LinkDB All DBs
Position
Unknown
AA seq 151 aa AA seqDB search
MVKAVCVLQGEVAGTLWFEQDSGSNPVKVTGEVTGLKPGLHGFHIHEFGDNTNGCTSAGP
HFNPLGKEHGGPEDSSRHVGDLGNVQAGADGVAKVNITDKMIALQGDHNIIGRTLVVHAD
PDDLGKGGHELSKTTGNAGARLACGVIGVTK
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaagcagtctgcgtattacagggcgaagttgccggaaccctttggttcgaacaa
gacagcggctcaaatcccgtcaaggtcactggagaagtaactggactcaagcccggtctc
catggtttccatatccacgagtttggggacaataccaatggatgtaccagtgctggaccg
cacttcaatccgctaggaaaggaacatggtggtcctgaggacagctccagacacgttgga
gatcttggtaatgtccaagctggtgcagatggtgttgccaaggtcaacatcactgataaa
atgatcgctcttcaaggagatcataatatcattggcagaactcttgtggttcatgctgac
cctgatgacttgggcaaaggtggtcacgagttgtcaaaaacaactggcaacgcaggagct
cgtttggcttgcggagtaattggagttactaaataa

DBGET integrated database retrieval system