KEGG   Microplitis demolitor: 103576754Help
Entry
103576754         CDS       T05600                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mdl  Microplitis demolitor
Pathway
mdl00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103576754
Enzymes [BR:mdl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     103576754
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 FAD_binding_2 EF-hand_1 EF-hand_6 FAD_oxidored EF-hand_8 EF-hand_9 EF-hand_5 GIDA Pyr_redox_2 FAD_binding_3 HI0933_like Thi4 NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 103576754
NCBI-ProteinID: XP_014298720
LinkDB All DBs
Position
Unknown
AA seq 720 aa AA seqDB search
MASLRLLAAGASAVGAGALSTYYLTSDSPVLADKALHKPIKRPLPTREEQVNTLKTQDEY
DVLIIGGGATGAGCALDACTRGLKTALIEGDDFASGTSSRSTKLIHGGVRYLQKAIMQAD
VEQYKMVKEALHERAQMLHSAPHLAHPLPIMLPVYTWWQIPYYWFGIKMYDLVAGSKTVK
SSYYLSKSNALELFPMLKGDKLTGAIVYYDGQQDDARMNLAVALSASRLGATVVNHVSVL
NLLKGLDKDGKRVLVGARVRDEMTGEEWDVKAKAIINATGPFTDSIRKMDDQTVQEICCP
SSGVHIVLPGYYSPDQMGLLDPATSDGRVIFFLPWQKQTIAGTTDLPCQVTHNPKPTEDE
IMFILQEVKNYLNPDVEVRRGDVLSAWSGIRPLVSDPNKPNTQSLARNHIVHVSPTNLVT
IAGGKWTTYRAMAQEAVDAAIDACKLEPTAECQTDGMLLEGAHGWSPTMYIRLVQDFGLE
CEVAQHLAKSYGDRAFAVAKMASLTGKRWPIIGKKIHPEFPYIDAEIRYGCREYARTAID
MIARRLRLAFLNVQASQEALPGIIDIMAEELKWSPDEKKKQQQQASEFLANEMGQMVNRA
SRDKIPINLTKDEIQLYIKRFQIIDKDRKGYVSINDIRRGLKLFGDKDVPGEELHEILRE
IDTNMNGQVELDEYLQMMSAIKSGHVAYSRFARMAEMEEAQHEKDVLKKKISVERSGGGL
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atggcctccctgagactattggctgcaggagcaagtgcagtgggagctggtgcactttca
acttattatcttacgtcagattcccctgtactggcggataaagcgcttcataaaccaata
aaacggcctctacctacacgtgaagagcaagtgaataccctaaaaacccaagacgaatac
gatgtcctaataattggtggtggtgctactggagcaggatgtgctttggacgcttgcaca
agaggtttaaagactgctctgatagagggagacgattttgcttcgggcacgtcgtcaaga
agcacaaaactgatccacggtggcgtgcgatatttacagaaagccattatgcaggcggat
gtcgagcagtataaaatggttaaagaagctctccatgagcgagctcaaatgctacatagt
gctccacacttggcacacccattgcctattatgttacctgtttacacgtggtggcagatc
ccttactactggtttggtattaagatgtatgaccttgtagctggcagcaaaactgttaaa
tcttcatattatttaagtaaatcaaacgcactcgaattatttcccatgttgaagggagac
aagcttactggagctatcgtttattacgatggtcagcaggacgacgccagaatgaatctc
gcggtggccttgtcagcttcacgcttaggtgcaacggtagtaaatcacgtgagcgttttg
aatttgctgaaaggattagacaaggacggtaagcgcgtgctggtgggtgcacgtgtcaga
gatgaaatgacaggagaagagtgggatgttaaagctaaagctattattaacgctaccgga
ccgtttactgatagtataagaaaaatggatgatcaaactgtacaagaaatctgttgtcca
tcttcgggcgttcatattgtacttcctgggtactacagtcccgatcaaatgggtctgctg
gatccagcgacaagtgacggccgtgtcatcttcttcttgccttggcagaagcaaactatc
gctggtactactgatttaccttgtcaggtgacgcacaacccgaaaccaactgaagacgag
attatgtttatcctgcaagaggtaaagaactaccttaatcctgacgttgaagtccgtcgt
ggtgatgttctgtcagcgtggagtggtatcagaccattggtttctgacccgaacaaacca
aacactcaatctcttgctcgtaaccacattgttcatgtgagtccaacaaatcttgttacc
attgctggaggaaagtggacgacttatcgtgcaatggcacaggaagctgttgatgcagca
attgatgcttgtaagttggagccaactgctgaatgtcaaactgacggaatgcttctggag
ggtgctcatggatggagtcctaccatgtacattagattggtacaggactttggattagaa
tgtgaagttgcccaacatttagctaaaagttacggtgatcgagcattcgctgtcgctaaa
atggcatcacttaccggaaagcgttggccaatcattggtaaaaaaattcatcccgagttt
ccttacattgacgctgagatccgttacggttgccgtgaatacgcaagaaccgcaattgat
atgattgccagacgattgcgactcgctttcctcaacgtccaagcgtcacaggaagctctg
ccgggtatcattgacataatggcggaagaattgaaatggtcaccggatgaaaagaaaaag
caacagcagcaggccagtgaatttttagcaaacgagatgggacaaatggtcaatcgcgcg
tcacgtgacaaaattccgatcaatctcacgaaagatgaaattcagctgtacattaaacga
ttccagattatcgacaaagatcgcaaaggatacgtatcaataaatgacattcgtcgcgga
cttaagctattcggcgacaaggacgttcccggcgaagagctccacgaaatacttcgcgaa
atcgacactaatatgaacggtcaagtcgagctggacgagtaccttcagatgatgtcagca
attaaatctggacacgtcgcgtactcgcgattcgcgcgaatggccgagatggaagaagcg
caacacgagaaagacgtgctgaagaagaaaataagtgttgagagatcaggcggaggtctt
tga

DBGET integrated database retrieval system