KEGG   Microplitis demolitor: 103577155Help
Entry
103577155         CDS       T05600                                 

Definition
(RefSeq) histone deacetylase 6 isoform X1
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
mdl  Microplitis demolitor
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mdl01009]
    103577155
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mdl03019]
    103577155
   04131 Membrane trafficking [BR:mdl04131]
    103577155
   03036 Chromosome and associated proteins [BR:mdl03036]
    103577155
Enzymes [BR:mdl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     103577155
Protein phosphatases and associated proteins [BR:mdl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     103577155
Messenger RNA biogenesis [BR:mdl03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     103577155
Membrane trafficking [BR:mdl04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    103577155
Chromosome and associated proteins [BR:mdl03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     103577155
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP zf-UBP_var
Motif
Other DBs
NCBI-GeneID: 103577155
NCBI-ProteinID: XP_008555902
LinkDB All DBs
Position
Unknown
AA seq 1082 aa AA seqDB search
MSGKQKSWSSNKNKSSLSKVKPSSELIAAKKKAAAEHKLKLQQTSQVPDTNFIHDIYQSA
MDSRDLSRKDTGLVYDNSMAEHECLWDKNYPECPKRLTRTLERCNELGLISRCKLISPRL
ATDKELLQKHTQKQIDILKATDGCTDLTKLEELSSRYDAIYIHPSTYKLSRLATGSTINL
LQSICRGEVQNGMAIIRPPGHHAMKSEYCGYCFFNNVGIAVESMLRDNLAKKVLIVDWDV
HHGQATQQMFYEDPRVVYFSIHRYEQGEFWPNLRESDYHYVGEGAGIGHNFNIPLNKTGM
TNADYLAIFQQVLLPMAYEYQPDLVVISAGYDAALGCPEGEMKITPAFYAHLLSQLLGLA
SGKVAVVLEGGYCLESLSESAALTLRCLLGDPCPMISSLEAPSLSIRDTILNVIYAQKPY
WSCYEYQDIYSIHSEDIKEECERHLPAVVFKGTETKPAVYETRNCYPVQSEIFLNDIRNQ
LISLQLTTNLIKSPNRVCLVYDERMLKHCNPCNNSHPEQPQRITGIFSKHEEYDLLKRCY
RIPGRVATEEELLLVHTELYVQVMKGIEKQKMSEVIKQSHVFESVYLHTETWSSACIAVG
SVLQVVDSVLNGESQSGVAIVRPPGHHAERDAACGFCIFNNVSIAARYAVEFHGCKRVLI
LDWDVHHGNGTQAIFEDDPKVLYISIHRYDNGSFFPSSVHANYNVVGNGKGEGFNVNIPW
NRKKMGDTEYIAAFQQIIMPIAYQFNPELILVSAGFDACIGDPLGGYSVSPVAYGHFTHW
LSSLANGRLILILEGGYNVNSISYSMTMCTKALLGDPLAPITRSTAALCTSAITSIKNVL
KTHKRYWPNLVFQAALPKENVIPQPASVSDKIYDVSPGAESKILQEEWQSEKNKIHELAK
EMKGLNVNQSEHVTKCPTGADNLQKAKPEEEKPGSSSSYQEVRPGSSKMSSDPPESRPLV
DSLMFAIIPLSDCPHLELIADVPPQGIDINSPCKECNSTAENWICLHCYSVNCARNINQH
AILHGQNEDHPMTLSFTDLSVWCYGCEAYVDNPRLHAAKSAAYLNKFNEELPWTYDEPRI
EM
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgtctgggaaacaaaaatcatggagcagcaacaaaaataaatcttcattatcaaaagtt
aaaccgtcaagtgaattaatagctgccaaaaaaaaagctgctgctgaacacaaattaaaa
cttcaacagacgagtcaagtaccagatactaattttattcacgatatttatcaaagtgca
atggattcacgggacttaagtcgcaaggacactggtcttgtttatgacaattcgatggcg
gagcatgaatgcctgtgggataaaaactatcccgagtgtccaaagagattgacaagaact
cttgagcggtgcaatgaactgggtttgattagtagatgtaaattaatcagcccaagattg
gctacggacaaagaattacttcagaagcatacccaaaagcaaatagatattctaaaagcc
actgatggatgtactgatctcacaaaacttgaagaattatcttcaagatacgacgctatt
tatattcatccatcaacatataaattatcaagattagcaactggatcaacaattaattta
ttgcaatccatttgtagaggagaagtacaaaatggaatggcaattataagaccaccggga
catcatgcaatgaaatcagagtactgcgggtactgtttcttcaacaatgtagggatagct
gttgagtcaatgctgagagacaatctagcaaaaaaagtattgatcgttgactgggatgtc
catcatggacaagcgacgcagcagatgttctatgaagatcctcgagtcgtatacttttcg
attcatcgctatgagcagggcgaattctggcctaatttaagagaatctgattatcattac
gtaggtgaaggcgcgggaattgggcataattttaatataccactaaataaaactggtatg
acgaacgctgattatctggcgatcttccaacaggttttgttacctatggcatatgagtat
caaccggatctcgttgtaatttcagcgggttatgatgcagcactcggttgccctgagggt
gaaatgaaaataacaccagcattttatgcacacttgctatcacaattacttggactagct
agtggtaaagtagcagtagttctcgaaggaggatattgtttagaatctttatcagaatcg
gcagctctgactttgcggtgtctgttgggagatccctgtccaatgatttcgagcctcgag
gctccttccttaagtatccgcgatactattctcaatgtaatttatgcccaaaaaccttat
tggagttgttacgagtaccaggatatttatagcatacactcagaagatatcaaagaagaa
tgtgaacgtcatcttccggcagtagttttcaaaggcactgaaacaaagccggcagtttat
gagacacgtaattgctatccagttcaaagtgagatttttctcaatgacatccgcaatcag
ttgatttccctccagctgacgacgaatttaataaaatctcctaatcgagtttgtctagtt
tacgacgagcggatgctgaaacactgcaacccatgcaacaatagtcatcctgagcagcct
caaagaatcaccggaatattttccaagcacgaagagtacgatttactcaaacgttgctac
cgaatcccaggccgcgtggccacagaggaagaacttctcttggttcatacggaactttac
gttcaagttatgaaaggtattgagaaacagaaaatgtctgaggttattaaacagtcacat
gtctttgagtccgtttatcttcacacagagacctggtcaagcgcctgtatagctgtgggt
tcagttctacaggtcgttgacagtgtattgaatggtgaaagtcaatcaggggtagcaatt
gtacgtccaccagggcatcatgcagagagagacgcagcatgtggtttctgtatcttcaat
aatgtctcaattgccgcgcgttacgcagttgaatttcacggatgcaaacgtgtgttgata
cttgactgggatgtccatcatggcaatggaactcaagcaatatttgaagatgaccccaag
gttctatacatttcaattcatcgttatgacaacgggtcatttttcccctcgtcagttcac
gccaattacaatgtcgtgggaaatggcaaaggtgagggattcaacgtaaatattccatgg
aatcgtaaaaaaatgggcgacaccgagtacattgcggcattccaacaaataattatgcca
atagcctatcaatttaatccggaattgattctagtgtccgctggattcgatgcatgcatt
ggagatcctcttggcggctacagcgtttctccagttgcttatggtcacttcactcactgg
ctgtcatctctggcaaacggccggttgattttaattctcgaaggtggttacaacgtaaac
tcaatctcttattcaatgaccatgtgcacgaaagcgcttcttggtgatcctctggcacca
ataacacgcagtacagctgccctctgtacatctgctattacgagtattaaaaatgttcta
aaaacgcacaaacgctactggccaaatctcgtgtttcaagcagcactgcctaaagaaaat
gtaatacctcaacccgctagtgtgagcgataaaatatacgacgtgagtcctggagcagag
tccaagatacttcaggaagaatggcagtcagagaaaaataaaatacacgaactggctaaa
gagatgaaggggttaaatgtaaatcagagtgaacatgtcacgaagtgtccaactggcgca
gataatctacagaaagccaaaccagaagaagagaaacctggatccagtagttcttatcaa
gaagtcagaccgggatcgtctaaaatgtccagcgatcctcccgaaagtagaccgctcgtt
gatagtctgatgtttgcaataatacctctgagtgattgtcctcacttagaattgatagct
gatgttcctccgcaaggtatcgacataaactcgccctgcaaagagtgcaatagtaccgcc
gaaaactggatctgcctccactgctacagcgtcaattgcgcaagaaatatcaaccaacat
gcaattctccatggccaaaacgaagatcatcctatgacactcagttttacggatctgtct
gtctggtgctacgggtgcgaagcctacgtcgacaacccgcgactccatgctgctaaaagt
gccgcttacctcaataaatttaatgaagaacttccttggacttatgacgagccgcgcata
gaaatgtga

DBGET integrated database retrieval system