KEGG   Microplitis demolitor: 103577336Help
Entry
103577336         CDS       T05600                                 

Definition
(RefSeq) pyrimidodiazepine synthase
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
mdl  Microplitis demolitor
Pathway
mdl00480  Glutathione metabolism
mdl00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103577336
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    103577336
Enzymes [BR:mdl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     103577336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 Glutaredoxin GST_C GST_C_3 GST_N_4
Motif
Other DBs
NCBI-GeneID: 103577336
NCBI-ProteinID: XP_008556151
LinkDB All DBs
Position
Unknown
AA seq 241 aa AA seqDB search
MSGKHLSTGSVAPPVVPGKLRLYSMRFCPYAQRVHLVLDTKKIPYDVVYINLTAKPEWLT
EKSPLGKVPCIEFEDGETLYESLIVADYLNEAHPDQNLYPSDPRAKAKDKILIERFNGLI
SLMYKFYLSPTVDRDMFEEALKVLEFFDRELVRRASPFFGGSKPGMVDLMIWPWFERADI
IRIMRGEQYVIPRERVPRIMEWKTAMKEDPGVKVSCLEPEVHAKYMKSRLAGTPQYDLLV
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgagcggaaaacatttgagtactggttctgtggcaccgccggtggttccaggaaaatta
cgtctttacagcatgagattttgtccttatgcccaacgagtacatctggttcttgatact
aaaaaaattccgtatgatgtcgtatacataaatttgacagctaaacctgaatggctgaca
gaaaaaagtccccttgggaaagtgccatgcattgaatttgaagatggcgaaactttatac
gaaagtcttatcgtagctgattatttgaatgaagctcatccagaccaaaatctctatccc
agcgacccaagagctaaggccaaggataaaattttaattgaacgtttcaatggattgatt
tcattgatgtacaaattttacctgtcgcctactgtagaccgtgacatgtttgaagaggca
ttgaaagtattagaattttttgacagggagttggttcgtcgggcaagtccattctttggt
ggaagtaaacctgggatggttgacttgatgatttggccatggtttgaaagggctgatatt
attcgaatcatgagaggtgaacaatatgtcattccacgtgaacgtgttcctcgtattatg
gaatggaaaacagcaatgaaagaagatccaggtgtgaaagtcagttgtctagaaccggaa
gtccatgctaaatatatgaaaagtcgtcttgctggtactccacaatacgatttgctggtt
aaataa

DBGET integrated database retrieval system