KEGG   Microplitis demolitor: 103577838
Entry
103577838         CDS       T05600                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein homolog B
  KO
K20017  Bcl-2 family protein
Organism
mdl  Microplitis demolitor
Pathway
mdl04214  Apoptosis - fly
mdl04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    103577838
   04215 Apoptosis - multiple species
    103577838
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 103577838
NCBI-ProteinID: XP_008556892
LinkDB
Position
Unknown
AA seq 275 aa
MVSRVANKSDDKLLSVPVNDRVRRSSLSLLNLPDSSSFQGVAGSARRRLSNVSDVVSKKI
SDTIGWRSVAANVELAVMQGSVLCGQFIKNRLKRSGIFQKKLGLKRMRSGGMMSSEGLLV
VAEVCPVLNSLGAELEKMYPKLYKNIARQIGAGSFSNEQSAAEAITDVSRELLRTGEMTW
SKIISLYSVAGGVAVDCVRQGKPEFIGAIQRAMTNVLEEDLASWIQANGGWIALSNRCRT
SIDADTWQERDTLILLVSTTVIMGLALLLRIFIFY
NT seq 828 nt   +upstreamnt  +downstreamnt
atggtatcgcgtgtggctaataaaagtgatgataaattattatctgtacctgtaaatgat
cgtgtacgaagaagtagcttgtcattattgaatttgccagatagttcatcatttcaaggt
gtcgcgggttctgctagacgacgattgagtaacgtcagtgatgttgtgtcgaaaaaaata
tcagatactatcggctggcgatctgttgctgctaatgttgaacttgctgtcatgcaggga
tcagtactttgcggtcaatttattaaaaatcgtctgaaacggtcgggaatatttcaaaaa
aagttgggattgaaaagaatgcgaagtggcggaatgatgtcatctgaaggattgctagtt
gtagcagaagtatgtccggtgttgaatagtttaggagctgaactagaaaagatgtatccg
aaattgtataaaaatattgcacggcaaataggagccgggtcattttccaatgaacaatct
gctgcagaagccatcactgatgtatcacgtgaattattgaggactggtgaaatgacatgg
agtaaaataatatcactgtactcagtggctggtggtgttgctgttgactgtgtccgtcaa
ggaaagcccgagtttatcggagctattcaacgtgcgatgacaaatgtccttgaagaagat
ttggcctcgtggattcaagccaatggaggatggattgcattaagtaatagatgccgtaca
agcattgatgcagacacatggcaagaacgtgacacattaattttacttgtttcaacgaca
gttattatggggcttgcattattattacggatattcattttctattaa

DBGET integrated database retrieval system