KEGG   Microplitis demolitor: 103579092Help
Entry
103579092         CDS       T05600                                 

Definition
(RefSeq) NF-kappa-B inhibitor cactus
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
mdl  Microplitis demolitor
Pathway
mdl04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    103579092
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mdl03000]
    103579092
   04131 Membrane trafficking [BR:mdl04131]
    103579092
Transcription factors [BR:mdl03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    103579092
Membrane trafficking [BR:mdl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    103579092
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_3 Ank Ank_5
Motif
Other DBs
NCBI-GeneID: 103579092
NCBI-ProteinID: XP_008558616
LinkDB All DBs
Position
Unknown
AA seq 167 aa AA seqDB search
MVPPEEIASASNPDIEGENILHFLCREGDITDLMAFKNVISDANRHLVLQFNRHGKQCVH
IVSNPGIADPQEKLKLLMEWGADINGQERVFGNTPLHIAAYTQNHKLATWLCNQPGINMG
ISNYLFKTPYYVACERHDIKIMNILRAKGGQCRIYRCNEAWLFTRNY
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggtgcctcccgaagaaatcgcctctgctagtaatcccgacattgaaggtgagaatata
cttcatttcctctgccgtgaaggcgatatcactgatttgatggctttcaagaatgtaatc
agcgatgccaatcgacatctggtgctgcaattcaaccgacatggaaaacagtgtgtccac
attgtctccaacccaggcattgctgaccctcaggaaaaactaaaacttctgatggagtgg
ggtgctgacatcaatggtcaagagcgagtttttggtaatacaccactgcatattgcagct
tatacgcaaaaccataagctcgcaacctggctgtgcaatcagcccggaataaacatggga
atatctaactatctattcaagacaccgtattatgtcgcgtgtgaacgtcatgatataaag
ataatgaacatattacgcgcgaaaggagggcaatgtagaatctaccggtgcaacgaagct
tggttatttactagaaattattaa

DBGET integrated database retrieval system