KEGG   Microplitis demolitor: 103580374Help
Entry
103580374         CDS       T05600                                 

Definition
(RefSeq) putative GPI-anchored protein PB15E9.01c
  KO
K11459  polycomb group RING finger protein 4
Organism
mdl  Microplitis demolitor
Brite
KEGG Orthology (KO) [BR:mdl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mdl03036]
    103580374
Chromosome and associated proteins [BR:mdl03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     103580374
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-RING_5 zf-rbx1 zf-RING_UBOX Prok-RING_4 zf-C3HC4_4 zf-Nse zf-RING_6
Motif
Other DBs
NCBI-GeneID: 103580374
NCBI-ProteinID: XP_008560317
LinkDB All DBs
Position
Unknown
AA seq 1505 aa AA seqDB search
MSGQSGGGDGGGGGRIRLANLNDQLTCKLCNGYFIDATTIIECLHSFCRSCIVKYLESNK
YCPICEVQVHKSKPLLNIRPDHTLQDIVYKLVPGCYQNEMRCRREFYEKHPEAQLSTMSP
EARGEPIESHIYSPDEVLTLSLEYYNPNLIDTTGVGVVIPLNETKELTASSISSGTGSAS
GGSNEVLPRRYLRCPAAVTVFHLQKLIRAKNGLSDVHRVDIMYKEESLCGNYTLMDVMYI
YHWRRKVPLHLSYRIFESSPKRLKLSDDNIHYRESLTKTGINFVPSSTSSSSSTSSSTSS
TSSTSPTTKESVKSDSKKDEWKEVQLKISETGETSVTVITNSDLKKLSKSSGSSTYSRVN
ETQPKNSIKAELTAPIDANSTKTDDKHKNNDESKSNSNESVPVKVEKDKIKSEKSETPAA
GVSGGSKIDALSVKLQFQPKVGQVNNTYSKRTPKDKGKVTITDNKLLKKSDTRLYLNDSQ
KPKVADKNRSTSSTSASSTPTSKPLSFTLVSFPQRNADNDKEQTPVKRKNDVNYNQRSGL
TITTTTCTSSSSSSTSTAGGKNSRVNSSNEDAGISGKLTITQATFPYTVQDLVSNAKKSV
TKPSDSPLHSPAVTYSVTTATTTTSSTSASSASSVSSSASASVSAAAASPGSNTSKTPTY
TSPCNNKSNDVNNSTIKINSNSSSSNNINNNINQSGGSTIIVPPCPDAIPIALMKPTVRK
TEIITKGTNLNEICAKIGGNAAASATSASTATPAASASSSSPSGSKINDICAKIGESTKE
KNSRLEIKSRPEIPDLLKITKKSMSSTNTSDNNTNAMIKHIANIPNIPIYTPSLSVSELR
GNSGNTTYSRDYLKMSTPSITVTTTTSTSPSINLTPTTSSITITPTSSMVITAAGQHQNA
SSFQRKKVMSKHGSGTGNLSTGSGGASGSSMSNYKTLREPPKSWNPVLSKNNYVAAKNQA
AKDLQNQTQLNAGSEPGDGKSIASKPAKIFKMRNVPRFLGNPASGVKPMYNINNESKDKE
SSSSSSNLSSASAAKLNSSGLSMTKIDPKTLSPITITPRTNTNSPIITPPPYSPNTSSSY
QNIPFSRGGASGSTTSNSSINTPLSPRNSPVNLLSTSPFIPSQTPNTNPRLIYTHHFHPS
VQPPPQYSNADLVRFSTNPLIRTSLSCLPSVPPNAAFHSSLPPAISKFFQRTTSYIPHTT
TVTYSQQGLANQSVAIQRIPSINNFTTTTSASSSLISTPSKSKTTVTNSQTFNSAKTEPN
REREISNLVKPTPETSAFNLSQASTATSTTTTTATATSSNLSSSNYASDLTKNSSPKVSA
DSQSLNKNVPCDGSSKGKDSKDQEEDRDKDKDKEKVEDKVDKDKNDDDKCKVKQEDDKGE
DDGKVAKKKIKDDKKTVKRLKKDEEDDKVDADVKEEKEELKVNGSSTSATGNPTSAEASV
NKSNEQVGKDSKGTTESAATANPVAEKDNPVFSEDDKGKESKVETEESNGKNKDIKISKP
ALNTE
NT seq 4518 nt NT seq  +upstreamnt  +downstreamnt
atgtctggacaaagtggaggtggagacggtggcggtggcggcagaattagactggcgaat
ttaaatgaccagttgacttgtaaattgtgtaatgggtattttattgatgcgacaacaatt
attgaatgtttacattcattttgccgcagctgtattgtcaagtacttggagagtaataaa
tactgtccgatatgtgaggtgcaagtacataaaagtaaaccgttactaaatatcagacct
gatcatacattgcaggatattgtttacaagctggttccaggatgttatcaaaatgaaatg
cgctgccgcagagaattttacgaaaaacatccagaagcccagctgtcaacaatgtcacca
gaagcacgtggcgagccgatagaatcccacatctactcgccagacgaagtgttgactctg
tccttggagtactacaacccgaatctcatcgataccacaggcgtgggagtagtgattcct
ctaaacgaaactaaagaattaacagcctcatcaatatcatcaggtactgggtcagcaagt
ggtggatcgaatgaagtcttacctcgccggtacttacgctgtcccgcagcagtgacagtt
ttccatcttcagaaattgattcgcgcgaaaaacggactcagtgacgtccaccgcgttgac
attatgtacaaagaggagtcgctctgcggtaactacactctcatggacgtcatgtacatt
taccactggagacggaaagttcctctgcacctcagctatcgtatattcgagtcgtcgccc
aagaggttgaaactttccgatgacaatattcactaccgggagtcgcttactaaaaccggt
attaattttgttccttcttcaacgtcatcctcatcgtcgacttcgtcttcgacttcttcg
acttcgtctacatcaccgacgaccaaagaatccgttaaaagtgacagcaaaaaggacgaa
tggaaagaagtacaactgaaaatatccgaaactggagaaactagtgtcaccgtcatcaca
aactctgacctcaaaaaattgtccaagtcatcagggtcatcgacttactcacgcgtcaat
gaaacgcagccgaaaaattcaataaaagctgaactgacggctccaattgacgctaattcg
acaaaaactgatgacaaacataaaaacaatgacgagtccaagtctaatagcaatgaaagt
gtcccagttaaagtggagaaagacaaaattaagagtgaaaaaagtgaaactccagctgct
ggagtcagcgggggatcaaaaatagacgcgctgagtgtaaaactccagttccaacctaaa
gtcggtcaggtaaacaacacgtactccaagagaacgccgaaagacaaaggaaaagtcacg
ataactgacaacaagttgctgaaaaaatctgatacccgtttgtatttaaacgacagccag
aaacccaaagtcgctgataaaaatcgttcgacttccagtacttccgcctcttcaaccccc
acatcaaagcctttgtcctttactttggtgtcatttccgcaacgaaatgccgataatgat
aaagaacaaaccccagtgaaacgtaaaaatgacgtcaattataatcaaaggtctgggctg
acaataacgacaacaacttgcacttcttcctcttcttcctcaactagcacagcaggtgga
aaaaattcacgtgttaattcatcaaatgaagacgctggaatttctggtaaactgacgata
actcaagcgacgtttccttatactgtacaagacttggtatcaaatgccaagaagtcagtc
acgaaacccagtgattccccgttgcattcaccggctgttacttattcggtaacgacagcc
accactaccacgtcatcaacttctgcatcttcagcatcatcagtatcatcgtcagcatca
gcatcagtatcagcagcagcagcatcacctggatcaaacacatcaaagactccaacttac
acgagtccatgcaataacaaaagcaacgatgtaaataatagtacgattaagataaatagt
aatagtagtagtagcaataatataaataataatataaatcaaagtggaggaagtacaata
atagtaccgccgtgtcctgacgcgataccgatcgcactaatgaagccgacggttcgtaag
acagaaattattaccaaaggaacgaatcttaatgaaatctgcgctaaaattggcggcaat
gctgctgcctcagcaacaagtgcgtcaacagcgaccccagcagcatcagcatcttcgtca
tcaccgtcaggctcgaaaataaatgacatttgcgctaaaatcggcgagagtacgaaggaa
aaaaatagcagactagaaataaaatcgcgcccagaaataccggatctgttaaaaataaca
aagaaatcgatgtcttcgacaaacaccagcgacaataacaccaacgcgatgataaaacat
atcgctaatattcctaatatcccaatttacacgcccagtttgtcggtatctgaattgcgc
ggtaattctggcaacacgacgtactcaagggattatttgaaaatgtcaactccaagtatt
accgttaccacaacgacctcaacatcgcctagtattaacttgactcccactacttcgtct
atcacaataacgccaacttcgtctatggtaatcacggcagcgggtcagcatcaaaacgcc
tcaagttttcagcgtaaaaaggttatgtcaaaacacggcagtggaaccgggaatttgagt
accggaagtggtggtgccagcggcagttcaatgagtaactacaagactctacgcgagccg
ccgaagtcatggaaccctgtgctgtcaaaaaataattacgtcgctgcgaaaaatcaagcc
gccaaggatttgcaaaatcaaacccaactgaacgctggatctgaaccaggtgacgggaaa
tcgatagcgtccaagccggctaaaatattcaagatgagaaacgtcccgagatttttaggt
aacccagcatctggagtcaagcccatgtacaatatcaataacgagtctaaagacaaagaa
tcatcttcttcttcttctaatttatcatcagcctcagcagcaaaattaaattccagcgga
ctgagtatgaccaaaatagaccctaagaccctgtcaccgataacgataacaccacgtacg
aatacaaactctcccataataacaccgccgccttactcaccaaatacatcaagtagttac
caaaatatcccattttcccgcggtggcgccagcggatccacgacaagtaactcaagtata
aatactccattatcaccacgtaattccccagttaatttactgtcaactagtccatttatt
ccttcgcaaacaccaaatacaaacccgcgtttaatttacacccatcacttccatccgtca
gtccaaccaccgccgcaatattcaaacgcagaccttgtcagattttcaacaaatccactg
ataagaacaagtctcagttgtttgccgtcagttccaccaaacgcggccttccacagcagc
ctgccaccggcgattagcaaatttttccaacgcactaccagctacataccgcacactact
acggtgacttactcgcagcagggtcttgctaatcagtctgttgctatacagagaataccg
agtataaataattttacgacaacaacatccgcttcgtcgtcgctgatatcaactcctagt
aaatccaaaacgacggtaacaaactcccagacttttaattctgcgaaaactgaacctaat
agagaaagagagatcagtaatttggttaaaccaacgccagaaacgagcgcttttaatctt
tcccaagcttccactgcgacttcgacgacaacaacaacggcaacggcaacgtctagtaat
ttgagtagcagcaattacgcatcggatttaactaaaaattcgtcgcctaaagtatctgcg
gatagtcagagtttgaataaaaatgtgccttgtgacggtagcagcaaaggtaaagacagc
aaagatcaggaagaagacagagataaggataaagataaagaaaaagttgaagataaagtt
gataaggataaaaatgatgatgataaatgtaaagtcaagcaggaagatgataaaggggaa
gatgacggcaaagttgcaaagaagaagataaaagatgataagaagacagtgaagagattg
aagaaagatgaggaagatgacaaagttgatgctgatgtcaaagaagaaaaagaagaactt
aaagtaaatggaagttcaacatccgcgactgggaatccaacttccgctgaggcgagtgta
aataaaagtaatgaacaagtgggtaaagatagtaaaggaacgactgaatcagcagcgaca
gcgaatccagttgcggaaaaagacaatccggtttttagtgaagatgataagggtaaagaa
agtaaagtagagacggaagaatcaaatggtaaaaataaagacattaaaataagcaagccg
gctttgaatacagagtga

DBGET integrated database retrieval system