KEGG   Malus domestica (apple): 103401166Help
Entry
103401166         CDS       T03194                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00020  Citrate cycle (TCA cycle)
mdm00190  Oxidative phosphorylation
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
mdm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    103401166
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    103401166
Enzymes [BR:mdm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     103401166
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA FAD_binding_3 Thi4 DAO HI0933_like Synthase_beta
Motif
Other DBs
NCBI-GeneID: 103401166
NCBI-ProteinID: XP_008338100
LinkDB All DBs
Position
15
AA seq 633 aa AA seqDB search
MWRCVSRGLGVSSSKRSASGDSLRSHFPRLFSSESATGRSPYTVVDHTYDAVVVGAGGAG
LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWL
GDQDAIQYMCREAPKAVIELENYGLPFSRTEDGRIYQRAFGGQSLDFGKGGQAYRCACAA
DRTGHALLHTLYGQAMKHNTQFFVEYFALDLLMDSEGTCQGVIALNMEDGTLHRFQASST
ILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPLKDHIYLHLNHLP
PDVLKERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGIPTNYHGEVLTIKGDDPDSI
IPGLMAAGETACASVHGANRLGANSLLDIVVFGRACANRVAEIHKPGEKQKPLAKDAGEK
TIAWLDKIRNSNGSLPTSKIRLNMQRIMQNNAAVFRTQETLEEGAQLIDKAWESFHEVQL
KDRSLIWNSDLIETIELENLLINACITMHSAEARKESRGAHAREDFTTRDDEKWIKHTLG
YWENEKVRLDYRPVHMNTLDDEIETFPPKARVY
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgctgcgtttctcgtgggcttggcgtttcttcctccaagagatccgcctccggt
gactctcttagatctcacttccccaggctcttctcctccgaatccgctacaggacgttct
ccgtacactgtggtggatcatacttatgatgctgtggttgtcggggctggtggtgcaggg
ctgagagcagccatcggactttcagagcatggatttaacaccgcttgcattactaagctt
tttccaactcgttcacacaccgttgcagcccagggtggtataaatgctgcattaggaaat
atgactgaggatgactggagatggcacatgtatgacacagtcaaaggaagcgattggctg
ggtgatcaagatgccatccaatatatgtgtagagaggctccgaaagctgtgattgaactt
gagaattatggattgccattttctcgaactgaagatggaagaatatatcaacgtgcattt
ggtggtcaaagtcttgactttggaaaaggtggacaggcataccgctgtgcttgtgccgct
gacagaactgggcatgctctattgcatactctctatggacaagctatgaaacataataca
caattttttgttgaatactttgctttggatcttttaatggacagtgaggggacctgccaa
ggagtcattgcattaaatatggaggatgggactttacatcggttccaagcatcatcaaca
attttggccacagggggttatggtagagcttatttttctgcaacctcagcccatacctgc
actggagatggtaatgccatggttgcacgtgctgggctcccgcttcaggatttggagttt
gtgcagtttcaccctactggtatatatggtgctgggtgcctcatcactgaaggatcacga
ggggaaggtggtatcctaagaaatagtgaaggtgagcgatttatggaacgatatgcccct
acagcgaaagatcttgcttctagggatgttgtgtcgagatctatgactatggaaatccgg
gagggtcgtggtgtaggacctttgaaggaccacatctatctccacttgaatcatttgccc
ccagatgtactgaaggagaggcttcctggtatctctgaaaccgctgccattttcgctggt
gtggatgttacaaaggagcctattcctgtcttacctactgtgcactataatatgggtgga
attccaacaaattaccacggagaggtacttaccatcaaaggagatgatccagattcaata
atacctgggttaatggcagcgggggagacagcctgtgcatctgttcacggtgccaatcgg
cttggtgcaaattcactccttgacattgttgtttttggtcgagcttgtgcaaatagagtt
gcagagatccataaaccgggggagaaacaaaagcctctggcaaaggatgctggagagaag
accattgcatggttggacaaaataaggaattctaatggctcattaccaacttcaaaaatc
cggttgaatatgcaacgaataatgcaaaataatgctgctgtgttccgcacacaggaaaca
ttagaagaaggtgctcagttgattgacaaggcttgggagagctttcatgaggttcaattg
aaggatcggagtttgatatggaactctgacttgatagagaccatagagttggaaaacctt
ttgataaatgcctgtatcaccatgcattctgctgaagccaggaaagaaagcagaggagca
catgctcgtgaagacttcacgacaagggatgatgagaaatggataaaacatacattggga
tactgggaaaatgagaaggtccgactagactacagaccggttcacatgaacacattagat
gatgaaatcgagacattcccacctaaagctcgtgtctactga

DBGET integrated database retrieval system