KEGG   Malus domestica (apple): 103403246Help
Entry
103403246         CDS       T03194                                 

Definition
(RefSeq) histone-lysine N-methyltransferase CLF
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    103403246
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mdm03036]
    103403246
Enzymes [BR:mdm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103403246
Chromosome and associated proteins [BR:mdm03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103403246
   Polycomb group proteins
    PRC2-EZH2 complex
     103403246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR BAR
Motif
Other DBs
NCBI-GeneID: 103403246
NCBI-ProteinID: XP_008340296
LinkDB All DBs
Position
2
AA seq 916 aa AA seqDB search
MASKASPSASANRSELHEDPPMTRSQENMDVTRKEISLLIENLKKQVVFNRATSIKKRME
VNKQKLAGVTNDMYKLSTERGSSRLTDASRSVDLLTKRQKDAFALQNGIELSNESNDSSQ
EDGHGSTAVLLESNVAVKSSVRPIKLPEVKRLPPYTXWIFLDRNQRMTEDQSVVGRRRIY
YDQNGGEALICSDSEEEAVDEEEEKRVFVESEDFILRSAIKEVGISDPVLESLAQYFSRS
PSEVKARYDTLLKEEEASGGCKNRDTEDSSQIGNSFLDKDLDAALDSFDNLFCRRCLVFD
CRLHGCSQDLVFPIEKQPLWRPPDDEKVSCGPNCYRSVLKSERIARVSNGDPEEKNATSL
DGASAQISTRKKSSRKKSKSGQSESASSNAKNISESSDSENGSRQGSDKNHQSPTKTRLA
GKSGIRKRNSKRVAERVLVCMQKRQKKMVVSDSDSIVNVGLCSSDMKFRSNSSKDNEDTS
SSSQKNLKSSTSGGFRRKESPAKGSNTVVQGESLDGALDEMIADPPATSSDDNLRREECV
DENIYKQELSDDKTWKTIEKGLFEKGREIFGSNSCLIARNLLNGMKTCWEVFQYMNFSES
KMSCQAGDAANSLVEGYSKGNNEARRRSKFLRRRGRVRRLKYTWKSAAYHSIRKRITERK
DQPCRQYNPCTCQTACGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKSQCRSRQCPC
FAADRECDPDVCRNCWVSCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLLGRSDISGWG
AFLKNSVPKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLK
FANHSPDPNCYAKVIMVAGDHRVGIFAKERIAAGEELFYDYRYEPDRAPAWARKPEASGS
KKDDGAPSSGRAKKLA
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgaaggcttcgccttcagcttccgccaatagatcggagcttcacgaggaccct
ccgatgacgagatcgcaagaaaacatggatgtaacccggaaggagatttcactgctcata
gaaaatctaaagaagcaagttgtttttaaccgggctacttctataaagaaaagaatggag
gtaaacaagcagaagttggctggtgtcaccaacgacatgtataaattgtcaacggaaaga
ggaagtagtaggttaactgatgctagtagaagtgtagatctattgacaaagaggcaaaaa
gatgcatttgccttgcaaaatggaattgaattaagcaatgagagcaacgatagctctcaa
gaagatggtcatgggtccacggcagttctactagaatctaatgtagcagtcaagagttct
gttcgtcctatcaagcttccggaagttaaaagactacccccttataccrcatggatattt
ttggacagaaaccaaagaatgacagaagatcagtcagtggtaggtcgaagaagaatttat
tatgatcaaaatggaggtgaagcgcttatatgtagtgatagtgaggaggaagcagttgat
gaagaagaggaaaaaagggtttttgttgaatctgaagactttatacttcgctcggctata
aaagaagttggcatctctgatccagtgctggagtcattagcacaatatttctctagaagt
ccatctgaagtcaaggcaagatatgatactctcttaaaggaagaggaggcttcgggggga
tgtaagaatagggatactgaagacagttcacaaattgggaattcttttcttgataaagat
ctggatgcagctctcgattcatttgacaacctattttgtcgtcgctgcctagtatttgat
tgcagattacatggatgttcacaggatcttgtctttcctattgagaaacaacctctttgg
agacccccagatgatgaaaaagtatcatgcggtccgaattgctatagatcagtactgaag
tctgaaagaattgctagagtgagcaatggtgatcctgaagaaaaaaatgccacgtcattg
gatggtgctagtgctcaaatatcaaccagaaagaaatcttctagaaagaagtcaaagtct
ggccaaagtgaaagtgcttcatcaaatgcaaaaaacatctcagaaagcagtgattcagag
aatggatccaggcagggtagtgataaaaatcatcaatcgcccacaaagactaggctagct
ggaaaaagtggaattcgtaagaggaacagcaagagagttgcagaacgtgttttagtttgc
atgcagaagaggcagaagaaaatggtggtttctgattccgattccattgttaatgttggt
ctttgttcaagtgatatgaagtttagatctaattcatccaaagataatgaagacactagt
tcttcttcacaaaagaatctgaaatcttctaccagtggagggtttaggaggaaggaatca
cctgccaagggcagtaatacagttgttcagggtgaatctcttgatggtgcattggatgag
atgatcgctgatccacctgccacaagtagtgatgacaatttgaggagagaagaatgtgtt
gatgaaaacatatataaacaagaattaagtgatgataaaacatggaaaaccattgagaag
ggcctttttgagaaaggcagagagatatttggcagcaacagctgcttaatagcaaggaac
cttttaaatggtatgaaaacgtgttgggaggtgtttcagtatatgaatttctcagagagt
aagatgtcctgccaagcaggtgatgctgcaaactcccttgttgaagggtattccaagggt
aataatgaagctagaagaagatcaaaatttttacgtagaaggggtagagttcgtcgtttg
aagtatacttggaaatctgctgcttaccattcaatcaggaaacgaattactgagagaaaa
gatcagccttgcaggcagtataatccatgtacttgccaaacagcttgtggaaaacagtgt
tcttgtctacaaaatgggacttgttgtgagaagtactgygggtgtccaaagacttgcaaa
aatagatttagaggctgtcattgtgctaaaagtcaatgccgaagccgtcagtgtccttgt
tttgctgcagacagggaatgcgatccggatgtttgtaggaattgctgggtcagttgcggt
gacggtacccttggggttccaagccaaagaggtgacaattatgagtgtagaaatatgaag
cttcttctgaaacaacagcaaagggtcttacttggaagatctgacatatctggctggggt
gcgttcttgaagaatagtgtccccaagcacgaataccttggtgagtatactggggagttg
atctcacatcgtgaagcagataagcgtggaaaaatatatgaccgtgaaaattcatcattt
ctcttcaatctgaacgatcagtttgtccttgatgcttatcgaaagggtgataaattgaag
tttgccaaccattctccagatccaaattgctatgcgaaggtcattatggttgcgggagat
cacagggtgggcatatttgccaaggaacgaattgcggcaggagaggaacttttctatgat
taccgttacgagcctgacagagctcctgcttgggcgcggaagcctgaggcatccgggtca
aaaaaggacgatggagctccttcaagtggtcgtgcgaagaagcttgcttaa

DBGET integrated database retrieval system