KEGG   Malus domestica (apple): 103404160Help
Entry
103404160         CDS       T03194                                 

Definition
(RefSeq) probable inactive shikimate kinase like 1, chloroplastic isoform X1
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mdm01100  Metabolic pathways
mdm01110  Biosynthesis of secondary metabolites
mdm01230  Biosynthesis of amino acids
Module
mdm_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    103404160
Enzymes [BR:mdm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     103404160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SKI
Motif
Other DBs
NCBI-GeneID: 103404160
NCBI-ProteinID: XP_008341267
LinkDB All DBs
Position
17
AA seq 286 aa AA seqDB search
MEITRSFLLHSSCSELPLRTPFRHSQVAASSFSIPITSRTHIRKPLATSCSASDGGDSSS
AAKVSVADLSSAVKNKAMDITPELKGTSIFLVGMKSSMKTSLGKLLANALRYYYFDSDSL
VEEAAGGESAAKSLRVADINGFRESETEVLKQLSSMGRLVVCAGDGAVQSSTNLALLRYG
ISVWIDVPVDLVASGMVEDQSQLPALNLSASASYQEVLTHLSTSYEEARGGYETADATVS
VEELAYQLGYDDLGDVTTENMALEVLKEIEKLTRVKKMMEAAARPF
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggagataacaaggagcttcctcctccattcttcttgctccgagctcccactccgcact
cccttccgccactctcaagttgcggcttccagtttctcaattccgattacctctcgcacc
cacatccgaaaacctctcgccacttcatgctccgcctccgacggcggcgattccagctca
gcagccaaggtttctgtagctgacctctcttctgcagtaaagaacaaggcaatggatata
acccctgagctgaagggaacttccatatttcttgtgggcatgaagagctccatgaaaacc
agtttggggaagctcctagccaatgcgttgcgatattattactttgacagtgatagtttg
gttgaggaagctgctggaggtgaatctgctgccaaatcgcttagggtggctgacataaat
ggttttcgggaatccgagactgaagtattgaagcaactgtcatccatgggtcgattggtg
gtttgtgccggagatggtgcggttcagagttcaactaatctggctcttctgaggtatgga
atctctgtatggattgatgtacctgtagacttggtggccagtggcatggtcgaagatcaa
agtcagcttcctgcactcaacctatctgcttcagcatcttatcaagaggttttgactcac
ctaagtacttcgtatgaagaagcgagaggtggatacgaaacagctgatgcaaccgtttcc
gttgaagaactagcttatcaattaggttatgatgaccttggtgatgtaacgacagaaaac
atggctttggaggttctcaaggagatagagaaactgaccagagtaaagaagatgatggaa
gcggccgcgagacctttttaa

DBGET integrated database retrieval system