KEGG   Malus domestica (apple): 103405540Help
Entry
103405540         CDS       T03194                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase-like
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00620  Pyruvate metabolism
mdm00710  Carbon fixation in photosynthetic organisms
mdm01100  Metabolic pathways
mdm01200  Carbon metabolism
Module
mdm_M00168  CAM (Crassulacean acid metabolism), dark
mdm_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
mdm_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
mdm_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    103405540
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    103405540
Enzymes [BR:mdm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     103405540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 103405540
NCBI-ProteinID: XP_008342775
LinkDB All DBs
Position
17
AA seq 967 aa AA seqDB search
MAARNLEKMASIDAQLRLLAPGKVSEDDKLVEYDALLLDRFLDILQDLHGESLRETVQDC
YELSAEYERKQDPQKLEELGKMLTSLDPGDSIVIAKSFSHMLNLANLAEEVQIAYRRRIK
LKKKGDFADEASATTESDIEETLKRLVGDLKKSPEEVFDALKNQTVDLVLTAHPTQSVRR
SLLQKHARVRNCLTQLYAKDITPDDKQELDEALQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYFSQIEDLMFXLSMWRCNDELRTRADELHRSSKKDAKQYIEFWKKI
PPNEPYRVILGDVRDKLYNTRERARQLLANGVSDIHEDTTFTNVEQFLEPLELCYRSLCS
CGDRVIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVINAITKHLEIGSYREWSEER
RQEWLLSELHGKRPLFDRDVPKTEEIADVLETFHVISELPSDNFGAYIISMATAPSDVLA
VELLQRECGVKKPLRVVPLFEKLADLEAAPAAVARLFSIDWYKNQINGKQEVMIGYSDSG
KDAGRLSAAWQLYKAQEELIKVAKQFGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTIH
GSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMHPPVSPKPEWRALMDEMAVIAT
KEYRSIVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQTR
FHLPVWLGFGAAFKHAIEKDAKNLQMLQEMYNHWPFFRVTIDLIEMVFAKGDPGIASLYD
KLLVSEDLWSFGDRLRSNYEETKRLVLQVAGHRALLEGDPYLRQRLLLRDSYITTLNVCQ
AYTLKQIRDPNYHVKVRPHLSKEYMETTSKPAAELVKLNPTSEYAPGLEDTLILTMKGIA
AGMQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaggaacttggagaagatggcttcaattgacgcccagctgaggcttttggca
cctgggaaggtctctgaggatgacaaactggttgagtacgatgctctgctgttggatcgc
ttccttgatattcttcaggatttacatggagagagtctcagagaaacggtgcaagattgt
tatgagctttccgcggaatatgaaagaaagcaggaccctcaaaagttggaggaactcggg
aaaatgctaacgagtttggatcccggggactccattgtcattgctaaatccttttctcac
atgcttaacttggcaaatttggccgaggaagttcagattgcgtaccggaggaggatcaag
ttgaagaagaagggagattttgctgatgaggcgtcggctactacggagtcagacattgaa
gagactctcaagaggcttgtgggggacctgaaaaagtccccagaagaagtttttgatgcc
ttgaagaaccagactgtagatttagttctgactgcacatcctactcagtctgttcgcagg
tctttgcttcaaaagcatgcaagggtaagaaattgtttgacgcagttgtatgctaaggac
attacgcctgatgataagcaggaactcgatgaggctttacaaagggagattcaagctgca
tttcgtacagatgaaatccgaaggactcctccaacccctcaagatgagatgagggcagga
atgagctacttccatgagacaatttggaaaggtgtaccaaaattcttacgtcgtgttgac
actgctttgaagaacatagggataaacgaacgtgttccttacaatgcccctctcattcag
ttttcttcttggatgggtggggatcgtgatggaaaccctagggtcactcctgaagttact
cgggatgtatgcttattggctagaatgatggctgctaacttatacttctcccagatagag
gatcttatgtttragttatctatgtggcgatgcaatgatgagcttcgcactcgtgctgat
gaacttcataggtcttcaaagaaggatgcaaaacagtacatagagttttggaaaaaaatt
cctccaaatgagccttatcgtgttattcttggtgatgtaagagacaagctttacaatacg
cgtgaacgtgctcgccagttattagccaatggagtctctgacattcatgaggayacaacg
tttaccaatgttgaacagtttctggagcctctcgaactttgttaccggtcactctgctcc
tgtggcgatcgagtaattgctgatggaagccttcttgatttcttacgacaagtttctact
tttgggctgtctcttgtgagactagacatacgacaagaatcagacaggcacactgatgtc
atcaatgctataacaaagcacctggagatagggtcttatcgagaatggtctgaggagcgt
cggcaagaatggctcttgtctgagcttcatggcaagcgccccctttttgaccgtgatgtt
cccaagactgaagaaattgctgatgtgctggaaacgttccatgtcatttcagaacttccc
tcagacaattttggtgcttatattatatcaatggcaacagccccatctgatgttctcgct
gttgagcttttacaacgtgaatgtggtgtgaagaagccactgagggttgttccattgttt
gagaagcttgctgatcttgaggctgctcctgctgctgtggctcgtctcttttcaatagac
tggtacaaaaaccagatcaatgggaagcaagaagtaatgatagggtactcagattccggg
aaggatgctggtcgtttatctgcagcatggcagttatacaaggctcaggaagagctcata
aaggttgcaaaacaatttggggttaagcttacgatgtttcatggtcgaggtggaacagtt
ggaagaggagggggccccacccatcttgctatattgtctcagccacccgacactattcat
ggttcacttcgtgttacagttcaaggtgaagttattgaacaatcatttggggaggaacac
ttgtgctttagaacactccagcgtttcacagcagctacacttgagcatggaatgcatcct
ccagtctccccaaagccagaatggcgtgcactcatggatgaaatggccgtcattgcaaca
aaggaatatcgttcaatagttttccaggagccccgttttgtggaatactttcgcctcgca
acaccggagttggagtatggtcgaatgaacattgggagtcgtccttcaaaacgaaagccc
agcggaggcattgaatcacttcgtgcaatcccatggatctttgcttggacccagacaaga
tttcacytaccagtgtggcttggcttcggggcagcatttaagcatgctattgagaaggat
gcaaagaatcttcaaatgctccaggagatgtataaccactggccttttttcagagtcaca
attgatttaattgagatggtgtttgccaagggcgatccgggtattgcatctctctatgac
aagcttcttgtgtcagaagacctatggtcatttggtgaccgattgaggtccaactatgag
gaaactaagcgcctcgtcctccaggttgctggacatagggctcttctggaaggagatcct
tacttgaggcagcgactcctccttcgtgattcatatatcacgacacttaacgtgtgccaa
gcctatacactgaagcagattcgtgatccaaactaccatgttaaagtaaggccacacttg
tcaaaggagtacatggaaacaacaagcaagccggcagcggagcttgtgaaactcaatcca
acgagcgagtatgctcctggtctagaggacacgcttattctgaccatgaagggtattgct
gctggcatgcagaacaccggttga

DBGET integrated database retrieval system