KEGG   Malus domestica (apple): 103405895Help
Entry
103405895         CDS       T03194                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mdm00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103405895
Enzymes [BR:mdm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103405895
Transporters [BR:mdm02000]
 Other Transporters
  Pores ion channels [TC:1]
   103405895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 Glutaredoxin GST_C_5 GST_N_4 GST_C_6
Motif
Other DBs
NCBI-GeneID: 103405895
NCBI-ProteinID: XP_008343141
LinkDB All DBs
Position
17
AA seq 220 aa AA seqDB search
MATEDVVLLDLWASPYCMRVKIALEEKGIKYEERAEDLFGGKSELLLTSNPVYAKVPVLL
HKGKPLCESSIIVGYIDETWASPPLLPSCPYARAQAKFWVDYVDKKLFDAGGNIWRTKGE
AQEVAVKDFIEILKQLEKVLGDKDFFGGDSFGFVDIITIAITSWFLAFEKFGNFKVEDHA
PKLSAWIKRSMQRETVAKVIPDPEKIYEFVINLKKMMGME
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggaagatgttgttctcttggacctctgggctagcccgtactgcatgagggtg
aagattgccttggaggaaaagggcatcaaatatgaagagagagctgaggatctctttgga
ggcaagagtgaactgctgctcacatccaacccggtttacgccaaggtgcccgtgcttctt
cacaagggaaaaccattgtgtgagtcaagcatcatcgtcggctacattgatgagacctgg
gcttccccaccattgctcccatcttgcccttatgctcgtgctcaggccaagttctgggtc
gactacgttgacaagaagctgttcgatgcaggaggcaatatatggagaaccaaaggagaa
gcacaagaggtggctgtaaaagacttcatagaaatcttaaagcagctagagaaagttctt
ggggacaaagatttcttcggtggcgatagctttggtttcgttgacatcataacgatcgct
ataacaagctggttccttgcattcgaaaaatttggaaacttcaaggttgaagaccacgca
ccaaagttgtcagcttggattaaaaggtccatgcagagagagacagtagccaaagtcatc
ccagacccagaaaaaatctatgaattcgtcatcaacctcaaaaaaatgatggggatggaa
tag

DBGET integrated database retrieval system