KEGG   Malus domestica (apple): 103412329Help
Entry
103412329         CDS       T03194                                 

Definition
(RefSeq) alpha-glucosidase-like
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00052  Galactose metabolism
mdm00500  Starch and sucrose metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    103412329
   00500 Starch and sucrose metabolism
    103412329
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     103412329
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 103412329
NCBI-ProteinID: XP_008349132
LinkDB All DBs
Position
10
AA seq 840 aa AA seqDB search
KLNNSDFYSEKTFSRHNLNHACSYETKDRLRIRITDSKKQRWEIPQDMIPRQTKPPTPHQ
HCISHDLVFTLRNTTPFGFTVTRCSSNDVIFDTSPHSSDPNTFLVFKDQYIQLSSSLPHN
RSSIFGLGEHTKSSFKIIPNQTLTLWNADIGSVNPDLNLYGSHPFYLDVRSASQDGGKTG
AGTSHGVLLLNSNGMDITYSGDRITYKVIGGIVDLYFFAGPTPELVVEQYTELIGRPAPM
PYWSFGFHQCRYGYKNVSDLEGVVAGYAKAGIPLEVMWTDIDYMDAYKDFTLDPVNFPLD
KMKKFVSTLHQNGQKYVLILDPGISNKDNYETYIRGKEADIFIKRDGIPYLGNVWPGDVY
YPDFAHPESEKYWANEIQIFQDALPFDGLWLDMNELSNFITSPPTPSSTFDDPPYKVNNS
GVLRPINEKTVPASALHFGNITEYNAHNLYGLLEAKATSNALINVTGKRPFILSRSTFVS
SGKYTAHWTGDNSAQWSDLAYTIPGILNFGLFGVPMVGADICGFSGNTTEELCRRWIQLG
AFYPFSRDHSEKFTIRQELYLWDSVAATSRKVLGLRYRLLPLFYTSMYEAHKKGTPIARP
LFFSFPQDITTYEINTQFLIGRGVMVSPVLKPGVNSVDAYFPAGNWFDLFNYSKSVSVSS
GQHVRLDAPPDHINVHVCEGNILALQGEALTTQAARKNAFELLVVVSSNRQSTGEVFLDD
GEEIEMGGEGGKWSLVRFYSGTENGTVFVSSEVVNGGFALSEKWIIDKVTFIGLEKVGHG
LEGYAFNVTKGANLNANSDIRASFDSSKQFVTVVISDISILIGSEFKLELKPKHATESTL
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
aagttaaataattcagatttttatagcgagaaaacattttcacgacataatcttaatcat
gcatgcagctatgaaaccaaagatcgtctaagaattcgaataacggactcaaagaagcaa
agatgggaaatcccacaagacatgatcccccgccaaaccaaaccccctaccccccaccag
cactgcatctcccacgaccttgtcttcactctccgcaacaccaccccattcggcttcacc
gtcacccgctgctcctccaacgacgtcatcttcgacacctccccccactcgtcagacccc
aacaccttcttggtcttcaaggaccaatacatccaactctcctcttctctcccccataac
agatcctccattttcggcctcggcgagcacaccaagtcctccttcaagatcattcccaat
cagacattgactctctggaatgccgacattggtagcgtcaatcccgacctcaacctttac
gggtcccaccccttctacctggacgtcaggtcggcgtctcaagatggcggcaagaccggt
gcaggaacatctcatggagtgctgctgctgaatagcaatggcatggacataacatacagc
ggtgataggattacttataaggtcatcggtggaattgtggacttgtacttctttgccggg
ccgacacctgagttggtagtggagcagtatacagaactaatcggccgccctgcccctatg
ccctactggtcttttggattccaccagtgtcgatatggttataagaatgtttccgatctt
gagggcgtggttgctggttatgcaaaagccggtatccctctggaagttatgtggacggac
attgattacatggatgcttacaaggacttcactctcgatcccgtcaactttccattggat
aagatgaagaaatttgtaagcactcttcaccaaaatggtcagaaatatgtcctcatcttg
gatcctggtatcagtaataaagacaactatgaaacctacatcagagggaaggaagcagat
attttcatcaaacgcgacggaattccttacctgggaaatgtatggcccggcgatgtgtac
tacccagactttgcacatccagaaagtgaaaaatattgggctaatgagatacaaatattt
caagatgctctaccttttgacggtctttggctcgatatgaatgagctgtccaatttcata
acctctcctcccactccatcttctacatttgatgaccctccttacaaggttaacaattct
ggagtcctgcgtccgatcaatgagaagactgttccggcatcagcgctgcactttggtaac
attacagaatataatgcacataacttgtacggactcttggaagccaaggcaacaagcaac
gccttaatcaatgtaactggtaaaagaccgtttatactttctagatcgacttttgtaagc
tccggtaagtacacagcacactggactggagacaattctgcacaatggagtgatctggca
tatacaattccaggcattttaaattttggacttttcggagttccaatggttggagctgat
atatgtggattctctggaaataccaccgaagaactctgccggcgatggattcagcttggg
gccttttaccccttttcaagagatcactccgaaaagtttacaatccgtcaagagctctat
ctatgggactcagtggcagcaacgtccaggaaggtgcttggactgcgctaccggttgctc
cccttattttacacatcaatgtatgaggcacacaaaaagggaaccccaattgcaagaccc
cttttcttctcatttcctcaagatatcacaacttacgagatcaatacgcagtttctaatt
ggtcgaggcgtaatggtctcacctgtgctgaaaccgggagtcaattcagttgatgcatat
tttcctgctggaaactggtttgatctcttcaactactcaaaatctgtgagtgtaagttca
ggacagcacgttaggttggatgcgccgcctgatcatatcaatgtgcatgtttgtgaagga
aatattttggcattgcaaggagaggccttgacaacacaagcagcccgaaagaatgctttc
gagcttttggtggtcgttagcagtaacagacaaagtacaggagaagttttcttggacgac
ggagaggaaattgaaatgggaggagagggaggcaagtggagtttagtgagattttatagt
ggaactgaaaatggaactgtatttgtaagctcagaggttgtaaatggaggattcgcttta
agtgaaaaatggatcattgataaagttaccttcattgggttggaaaaggttggtcatgga
ttggaagggtatgcattcaacgttactaagggagcaaatttgaacgcaaactcggatatc
agagccagctttgacagcagtaagcagtttgtcacagtagtgatttccgacatatcgatt
cttataggatcagagtttaagttggagctgaagccgaagcacgctaccgaaagcactttg
tag

DBGET integrated database retrieval system